Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Csa06g01182 ATGGCAGCTTCATCCATGGCTCTCTCCTCCCCTTCCTTCGCCGGCCAAGCCGTCAAATTATCCCCCACCGCCTCCGACCTCCTCGGCGAAGGCCGCATTACCATGAGAAAAACCGCCGGAAAGCCCAAGCCCGTTTCCTCCGGTAGCCCATGGTACGGCCCCGATCGTGTCAAATACCTTGGCCCATTCTCTGGAGAACCCCCATCCTATCTTACCGGAGAATTCCCCGGTGACTACGGTTGGGACACTGCCGGCCTCTCCGCCGACCCCGAAACCTTCGCCAAAAACCGTGAACTCGAAGTAATCCACTCGAGATGGGCCATGCTCGGAGCCTTAGGCTGCGTATTCCCGGAGCTCCTCTCCCGCAACGGAGTCAAATTCGGCGAGGCTGTGTGGTTCAAAGCTGGATCACAAATCTTCAGCGAAGGTGGGCTCGACTACTTGGGGAACCCAAGCTTGGTGCACGCACAGAGCATTCTAGCGATTTGGGCTTGTCAAGTAGTGCTCATGGGCGCAGTGGAAGGGTACAGAATTGCTGGGGGTCCGTTGGGTGAAATCACTGACCCGATTTACCCAGGTGGGAGCTTTGATCCATTGGGGCTGGCTGATGATCCAGAGGCATTCGCGGAATTGAAAGTGAAGGAGCTTAAGAATGGTAGATTGGCTATGTTCTCGATGTTCGGATTTTTCGTACAAGCAATTGTAACTGGGAAAGGGCCATTGGAGAATTTGGCTGATCACTTGGCTGACCCTGTTAACAACAATGCTTGGGCCTATGCTACTAACTTTGTACCTGGAAAGTGA 804 54.35 MAASSMALSSPSFAGQAVKLSPTASDLLGEGRITMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK* 268
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
6 9988814 9990198 + CsaV3_6G013800.1 Csa06g01182 532809

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Csa06g01182 267 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 3, CHLOROPLASTIC 1 267 - -
Csa06g01182 267 SUPERFAMILY Chlorophyll a-b binding protein 50 264 - -
Csa06g01182 267 Pfam Chlorophyll A-B binding protein 67 233 IPR022796 -
Csa06g01182 267 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 1 267 IPR001344 GO:0009765|GO:0016020
Csa06g01182 267 Gene3D Chlorophyll a/b binding protein domain 58 260 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Csa06g01182 K08912 LHCB1; light-harvesting complex II chlorophyll a/b binding protein 1 - csv:101213845 546.199
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Csa05g03116 Csa-Chr5:31132138 Csa06g01182 Csa-Chr6:9988814 5.87E-67 dispersed
Csa06g01182 Csa-Chr6:9988814 Csa06g03767 Csa-Chr6:29986415 0 dispersed
       

Deco-Alignment


Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi12g46 . . . . . . . . . . Cma02g00036 Cma20g00260 . . . . . . . . . . . . Cla02g01804 Cam02g1907 Cec02g1928 Cco02g1970 Clacu02g1889 Cmu02g1834 Cre02g2152 . . . . Lsi10g01537 . Chy11g01011 . . . . . . . . . . Cmo02g00036 Cmo20g00287 . . . . Cpe16g00726 . Bhi10g00982 . . . . . . . . . . . . . . Csa06g01182 . Cme11g01575
Vvi19g967 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Csa06g01182 . .
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Csa01g02395 . 1 399 Chloroplast and Mitochondria Gene Families AT2G28800 64.4 8.4e-135 477.2
Csa02g01790 . 71 412 Chloroplast and Mitochondria Gene Families AT2G28800 55.9 4.1e-97 352.1
Csa06g00534 . 3 256 Chloroplast and Mitochondria Gene Families AT1G15820 80.1 2.1e-117 418.7
Csa01g01655 . 3 156 Chloroplast and Mitochondria Gene Families AT1G15820 74.4 2.5e-62 235.7
Csa07g00262 . 1 266 Chloroplast and Mitochondria Gene Families AT3G27690 89.9 1.1e-144 509.6
Csa06g01182 . 2 268 Chloroplast and Mitochondria Gene Families AT3G27690 78.8 9.6e-122 433.3
Csa06g03766 . 2 266 Chloroplast and Mitochondria Gene Families AT3G27690 76.4 9.0e-120 426.8
Csa06g03767 . 1 266 Chloroplast and Mitochondria Gene Families AT3G27690 77.2 2.6e-119 425.2
Csa03g02852 . 1 266 Chloroplast and Mitochondria Gene Families AT3G27690 77.3 5.8e-119 424.1
Csa01g02243 . 2 266 Chloroplast and Mitochondria Gene Families AT3G27690 77.1 7.6e-119 423.7
Csa03g00595 . 5 265 Chloroplast and Mitochondria Gene Families AT3G27690 66.8 5.7e-98 354.4
Csa04g02748 . 44 260 Chloroplast and Mitochondria Gene Families AT3G27690 52.1 8.6e-54 207.6
Csa05g03116 . 70 273 Chloroplast and Mitochondria Gene Families AT3G27690 52.6 1.4e-51 200.3
Csa05g02208 . 3 272 Chloroplast and Mitochondria Gene Families AT3G61470 79.6 1.3e-127 452.6
Csa01g03007 . 58 263 Chloroplast and Mitochondria Gene Families AT3G61470 65.5 8.6e-87 317.0
Csa01g00241 CCT,ECH 22 249 Chloroplast and Mitochondria Gene Families AT3G61470 51.3 6.0e-64 241.1
Csa05g01755 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 82.6 2.2e-91 332.0
Csa04g01602 . 3 284 Chloroplast and Mitochondria Gene Families AT3G08940 84.1 1.0e-136 483.0
Csa04g02748 . 44 267 Chloroplast and Mitochondria Gene Families AT1G76570 80.4 1.9e-115 412.5
Csa01g03255 . 1 274 Chloroplast and Mitochondria Gene Families AT1G61520 85.8 8.2e-136 479.9
Csa07g00262 . 1 266 Chloroplast and Mitochondria Gene Families AT2G05070 90.2 7.2e-145 510.0
Csa06g01182 . 7 268 Chloroplast and Mitochondria Gene Families AT2G05070 79.4 9.4e-121 429.9
Csa06g03766 . 5 266 Chloroplast and Mitochondria Gene Families AT2G05070 77.9 2.3e-119 425.2
Csa01g02243 . 7 266 Chloroplast and Mitochondria Gene Families AT2G05070 79.2 3.0e-119 424.9
Csa06g03767 . 1 266 Chloroplast and Mitochondria Gene Families AT2G05070 78.2 3.0e-119 424.9
Csa03g02852 . 27 266 Chloroplast and Mitochondria Gene Families AT2G05070 84.6 2.0e-118 422.2
Csa03g00595 . 11 265 Chloroplast and Mitochondria Gene Families AT2G05070 68.9 1.3e-98 356.3
Csa04g02748 . 44 260 Chloroplast and Mitochondria Gene Families AT2G05070 51.2 2.4e-52 202.6
Csa07g00262 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.9 1.2e-125 446.4
Csa06g01182 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 77.8 9.0e-102 367.1
Csa01g02243 . 7 237 Chloroplast and Mitochondria Gene Families AT2G05100 78.0 3.4e-101 365.2
Csa06g03766 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.1 2.2e-100 362.5
Csa03g02852 . 27 237 Chloroplast and Mitochondria Gene Families AT2G05100 83.4 2.9e-100 362.1
Csa06g03767 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.6 3.8e-100 361.7
Csa03g00595 . 11 236 Chloroplast and Mitochondria Gene Families AT2G05100 68.1 7.1e-83 304.3
Csa05g03116 . 70 257 Chloroplast and Mitochondria Gene Families AT2G05100 51.8 3.2e-43 172.6
Csa04g01602 . 3 167 Chloroplast and Mitochondria Gene Families AT2G40100 72.8 1.2e-66 249.6
Csa06g01182 . 1 268 Chloroplast and Mitochondria Gene Families AT1G29930 89.2 8.6e-138 486.5
Csa01g02243 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 86.6 5.7e-134 473.8
Csa06g03766 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 87.7 5.7e-134 473.8
Csa06g03767 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 87.3 1.3e-133 472.6
Csa03g02852 . 4 266 Chloroplast and Mitochondria Gene Families AT1G29930 84.6 2.6e-126 448.4
Csa07g00262 . 3 266 Chloroplast and Mitochondria Gene Families AT1G29930 78.7 2.4e-116 415.2
Csa03g00595 . 34 265 Chloroplast and Mitochondria Gene Families AT1G29930 70.8 5.3e-95 344.4
Csa05g03116 . 53 273 Chloroplast and Mitochondria Gene Families AT1G29930 51.1 1.7e-53 206.5
Csa06g01182 . 1 268 Chloroplast and Mitochondria Gene Families AT1G29920 88.8 3.3e-137 484.6
Csa01g02243 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 86.2 2.2e-133 471.9
Csa06g03766 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 87.3 2.2e-133 471.9
Csa06g03767 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 86.9 4.9e-133 470.7
Csa03g02852 . 4 266 Chloroplast and Mitochondria Gene Families AT1G29920 84.6 3.4e-126 448.0
Csa07g00262 . 30 266 Chloroplast and Mitochondria Gene Families AT1G29920 83.8 3.2e-116 414.8
Csa03g00595 . 34 265 Chloroplast and Mitochondria Gene Families AT1G29920 70.8 5.3e-95 344.4
Csa05g03116 . 53 273 Chloroplast and Mitochondria Gene Families AT1G29920 51.1 1.7e-53 206.5
Csa06g01182 . 1 268 Chloroplast and Mitochondria Gene Families AT1G29910 88.8 3.3e-137 484.6
Csa01g02243 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 86.2 2.2e-133 471.9
Csa06g03766 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 87.3 2.2e-133 471.9
Csa06g03767 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 86.9 4.9e-133 470.7
Csa03g02852 . 4 266 Chloroplast and Mitochondria Gene Families AT1G29910 84.6 3.4e-126 448.0
Csa07g00262 . 30 266 Chloroplast and Mitochondria Gene Families AT1G29910 83.8 3.2e-116 414.8
Csa03g00595 . 34 265 Chloroplast and Mitochondria Gene Families AT1G29910 70.8 5.3e-95 344.4
Csa05g03116 . 53 273 Chloroplast and Mitochondria Gene Families AT1G29910 51.1 1.7e-53 206.5
Csa05g03116 . 11 289 Chloroplast and Mitochondria Gene Families AT4G10340 84.4 4.5e-137 484.2
Csa06g03766 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 6.0e-57 218.0
Csa06g03767 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 6.0e-57 218.0
Csa01g02243 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 51.6 7.8e-57 217.6
Csa06g01182 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.0e-56 217.2
Csa03g02852 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 53.6 1.7e-56 216.5
Csa07g00262 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 2.8e-54 209.1
Csa03g00595 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 2.0e-52 203.0
Csa06g01182 . 1 268 Chloroplast and Mitochondria Gene Families AT2G34420 89.2 5.5e-137 483.8
Csa01g02243 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34420 86.2 1.1e-132 469.5
Csa06g03766 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34420 86.9 2.4e-132 468.4
Csa06g03767 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34420 86.6 5.3e-132 467.2
Csa03g02852 . 4 266 Chloroplast and Mitochondria Gene Families AT2G34420 85.0 5.2e-127 450.7
Csa07g00262 . 3 266 Chloroplast and Mitochondria Gene Families AT2G34420 77.2 1.4e-116 416.0
Csa03g00595 . 34 265 Chloroplast and Mitochondria Gene Families AT2G34420 71.2 5.2e-95 344.4
Csa05g03116 . 53 273 Chloroplast and Mitochondria Gene Families AT2G34420 50.2 8.4e-53 204.1
Csa06g01182 . 1 268 Chloroplast and Mitochondria Gene Families AT2G34430 88.1 1.4e-135 479.2
Csa01g02243 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34430 86.5 1.8e-135 478.8
Csa06g03766 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34430 88.0 1.8e-135 478.8
Csa06g03767 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 4.0e-135 477.6
Csa03g02852 . 4 266 Chloroplast and Mitochondria Gene Families AT2G34430 85.3 7.2e-129 456.8
Csa07g00262 . 30 266 Chloroplast and Mitochondria Gene Families AT2G34430 82.9 2.3e-114 408.7
Csa03g00595 . 34 265 Chloroplast and Mitochondria Gene Families AT2G34430 71.9 2.3e-95 345.5
Csa04g01602 . 2 284 Chloroplast and Mitochondria Gene Families AT5G01530 85.2 2.6e-140 495.0
Csa03g00695 . 48 308 Chloroplast and Mitochondria Gene Families AT5G40810 93.1 7.8e-144 506.5
Csa03g00695 . 1 308 Chloroplast and Mitochondria Gene Families AT3G27240 86.4 3.8e-150 527.7
Csa06g01392 . 5 324 Chloroplast and Mitochondria Gene Families AT2G30160 75.4 1.4e-142 502.7
Csa04g01643 . 9 311 Chloroplast and Mitochondria Gene Families AT2G30160 65.2 9.0e-113 403.7
Csa06g01392 . 5 327 Chloroplast and Mitochondria Gene Families AT1G07030 74.8 1.6e-141 499.2
Csa04g01643 . 5 311 Chloroplast and Mitochondria Gene Families AT1G07030 68.5 2.2e-119 425.6
Csa07g01874 . 1 305 Chloroplast and Mitochondria Gene Families AT2G47490 76.1 6.1e-135 477.2
Csa05g02065 . 11 312 Chloroplast and Mitochondria Gene Families AT2G47490 64.9 7.2e-112 400.6
Csa05g02065 . 10 364 Chloroplast and Mitochondria Gene Families AT1G25380 62.9 3.4e-121 431.8
Csa07g01874 . 11 297 Chloroplast and Mitochondria Gene Families AT1G25380 64.2 4.0e-106 381.7
Csa01g01178 . 6 585 Chloroplast and Mitochondria Gene Families AT4G21490 75.0 1.2e-258 889.0
Csa06g01045 . 1 586 Chloroplast and Mitochondria Gene Families AT4G21490 68.3 7.1e-238 820.1
Csa07g00414 . 1 575 Chloroplast and Mitochondria Gene Families AT4G21490 64.1 3.4e-224 774.6
Csa07g02377 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 65.4 4.8e-63 237.7
Csa07g02377 . 22 191 Chloroplast and Mitochondria Gene Families AT3G04800 55.8 6.6e-44 174.1
Csa07g02377 . 15 191 Chloroplast and Mitochondria Gene Families AT1G72750 69.2 3.4e-64 241.5
Csa05g02570 . 1 222 Chloroplast and Mitochondria Gene Families AT1G26100 60.4 1.8e-70 262.7
Csa05g03088 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 70.9 5.2e-91 330.9
Csa03g04686 . 23 218 Chloroplast and Mitochondria Gene Families AT4G25570 73.5 1.1e-82 303.5
Csa05g01961 . 5 222 Chloroplast and Mitochondria Gene Families AT1G14730 51.4 6.9e-64 240.7
Csa05g01668 . 9 371 Chloroplast and Mitochondria Gene Families AT5G14040 81.3 8.2e-171 596.7
Csa01g00018 . 26 334 Chloroplast and Mitochondria Gene Families AT5G14040 84.6 1.8e-154 542.3
Csa03g02562 . 3 266 Chloroplast and Mitochondria Gene Families AT5G14040 80.3 6.2e-126 447.6
Csa07g00198 . 11 298 Chloroplast and Mitochondria Gene Families AT5G14040 52.7 5.3e-85 311.6
Csa05g01668 . 8 359 Chloroplast and Mitochondria Gene Families AT3G48850 70.9 2.2e-144 508.8
Csa01g00018 . 27 334 Chloroplast and Mitochondria Gene Families AT3G48850 74.7 8.0e-139 490.3
Csa03g02562 . 3 272 Chloroplast and Mitochondria Gene Families AT3G48850 76.7 1.7e-120 429.5
Csa07g00198 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 50.9 1.9e-84 309.7
Csa07g00198 . 14 311 Chloroplast and Mitochondria Gene Families AT2G17270 75.8 1.8e-131 465.7
Csa05g01668 . 63 353 Chloroplast and Mitochondria Gene Families AT2G17270 52.2 7.4e-85 310.8
Csa03g02562 . 3 271 Chloroplast and Mitochondria Gene Families AT2G17270 50.2 1.7e-73 273.1
Csa05g03044 . 1 269 Chloroplast and Mitochondria Gene Families AT5G15640 77.6 1.2e-117 419.9
Csa03g01544 . 17 320 Chloroplast and Mitochondria Gene Families AT5G15640 50.3 3.7e-79 292.0
Csa04g02565 . 12 345 Chloroplast and Mitochondria Gene Families AT5G26200 68.3 1.3e-125 446.4
Csa07g02371 . 1 347 Chloroplast and Mitochondria Gene Families AT5G26200 57.3 4.2e-105 378.3
Csa07g02371 . 1 351 Chloroplast and Mitochondria Gene Families AT1G72820 74.9 3.5e-147 518.1
Csa04g02565 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 67.9 1.9e-129 459.1
Csa05g00252 CCT,ECH 81 286 Chloroplast and Mitochondria Gene Families AT5G52570 52.2 2.7e-47 185.7
Csa03g01745 CCT,ECH 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 61.5 1.7e-67 252.7
Csa05g00252 CCT,ECH 68 204 Chloroplast and Mitochondria Gene Families AT4G25700 73.0 1.9e-53 206.1
Csa07g00401 . 133 311 Chloroplast and Mitochondria Gene Families AT4G03320 51.7 4.3e-55 211.8
Csa03g00597 . 69 357 Chloroplast and Mitochondria Gene Families AT5G54290 80.1 1.9e-121 432.6
Csa01g01943 . 53 547 Chloroplast and Mitochondria Gene Families AT2G18710 85.3 7.2e-240 826.6
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0000158 13 5 7 13 5 6 0 6 5 5 5 5 10 6 7 9 5 6 7 6 6 18 5 5 6 7 8 8 5 2 201
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Csa06g01182 Csa_Chr06 FPKM 5.800593 6.510015 1.473599 1.381849 3.996559 4.315238 4.36397 4.603097 4.507774 4.52567