Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Csa06g01683 ATGACTGTAATCGACATCATCTTCCGAGTCGATTCCATTTGCAAGAAATACGACAAGTATGATGTCGAGAAACAGCGTGAGCTCAATGCTTATGGTGATGATGCCTTCGCTCGCCTCTTCGCCGCCGTCGAACTCGAAATCCACGCCGCTCTTCAGAAATCTGAGGTTGCTTCAACTGAGACGAATAGGGCTGCTGCTGTTGCGATGAACGCTGAGGTTCGACGGAAGAAGGCTCGATTGATGGATGAAGTCCCTAAGCTTCGTAAATTGGCTCACAAGAAGGTTAAAGGGGTTCCAAAAGAAGAGCTGGAGGTCAGAGATGATCTTGTTCTTGCACTAGAAGAGAAGATTAAAGCCATACCAGATGGGAATACCTCAGGAGCCAAACATTCTGGAGGATGGGGCTCCTCCTCCTCATCTAACAATATCAAGTTTGATTCATCATCAGATGGAAACTTCGAGAGCGAGTATTTCCAGCAAAGTGAAGAATCGAGTCAATTTCGAAATGAGTATGAAATGCGGAAGATGAAACAGGACCAAGGTCTTGATGTCATATCCGAAGGTTTGGACATGCTGAAAAATCTAGCTCATGATATGAACGAGGAATTGGACAGGCAAGTTCCGTTAATCGACGAGATCGACTCTAAGGTGGACAAGGTGACTGACGAGATTAAAAACACCAATGTTAGGCTCAAGGAAACACTCTATGAGGTGAGAAGTAGCCAAAACTTTTGCATTGATATCATTCTTCTCTGTGTAATTCTTGGAATTGCTTCTTACTTGTACAACATATTGAGTTGA 801 43.95 MTVIDIIFRVDSICKKYDKYDVEKQRELNAYGDDAFARLFAAVELEIHAALQKSEVASTETNRAAAVAMNAEVRRKKARLMDEVPKLRKLAHKKVKGVPKEELEVRDDLVLALEEKIKAIPDGNTSGAKHSGGWGSSSSSNNIKFDSSSDGNFESEYFQQSEESSQFRNEYEMRKMKQDQGLDVISEGLDMLKNLAHDMNEELDRQVPLIDEIDSKVDKVTDEIKNTNVRLKETLYEVRSSQNFCIDIILLCVILGIASYLYNILS* 267
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
6 14745227 14748436 + CsaV3_6G021780.1 Csa06g01683 533310

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Csa06g01683 266 Coils Coil 210 230 - -
Csa06g01683 266 PANTHER SYNTAXIN 1 263 IPR045242 -
Csa06g01683 266 CDD SNARE_Qc 177 233 - -
Csa06g01683 266 SUPERFAMILY SNARE fusion complex 168 232 - -
Csa06g01683 266 Pfam SNARE domain 209 258 IPR000727 -
Csa06g01683 266 Gene3D - 172 233 - -
Csa06g01683 266 PANTHER SYNTAXIN-72 1 263 - -
Csa06g01683 266 ProSitePatterns Syntaxin / epimorphin family signature. 178 217 IPR006012 GO:0005484|GO:0006886|GO:0016020
Csa06g01683 266 MobiDBLite consensus disorder prediction 129 146 - -
Csa06g01683 266 SMART tSNARE_6 167 234 IPR000727 -
Csa06g01683 266 MobiDBLite consensus disorder prediction 122 146 - -
Csa06g01683 266 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 172 234 IPR000727 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Csa06g01683 K08506 SYP7; syntaxin of plants SYP7 - csv:101211289 471.855
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Csa03g03265 Csa-Chr3:29857638 Csa06g01683 Csa-Chr6:14745227 8.53E-133 dispersed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Csa02g02340 . 479 810 SNARE and Associated Proteins AT3G24350 64.6 2.1e-102 369.4
Csa04g01137 . 1 310 SNARE and Associated Proteins AT1G08560 67.9 9.7e-101 363.6
Csa06g03248 . 1 303 SNARE and Associated Proteins AT2G18260 54.2 2.8e-84 308.9
Csa03g03501 . 22 279 SNARE and Associated Proteins AT3G11820 80.6 1.0e-113 406.8
Csa06g02729 . 25 284 SNARE and Associated Proteins AT3G11820 70.4 8.4e-100 360.5
Csa06g02728 . 25 284 SNARE and Associated Proteins AT3G11820 69.6 4.1e-99 358.2
Csa01g01182 . 26 281 SNARE and Associated Proteins AT3G11820 65.0 1.4e-91 333.2
Csa03g04004 . 26 285 SNARE and Associated Proteins AT3G11820 51.2 1.2e-66 250.4
Csa03g03501 . 31 279 SNARE and Associated Proteins AT3G52400 69.5 1.7e-90 329.7
Csa06g02729 . 19 284 SNARE and Associated Proteins AT3G52400 63.0 1.7e-85 313.2
Csa06g02728 . 36 284 SNARE and Associated Proteins AT3G52400 65.5 8.2e-85 310.8
Csa01g01182 . 1 281 SNARE and Associated Proteins AT3G52400 56.0 1.6e-80 296.6
Csa01g01182 . 1 299 SNARE and Associated Proteins AT4G03330 67.2 2.0e-106 382.5
Csa03g03501 . 1 278 SNARE and Associated Proteins AT4G03330 57.2 9.9e-82 300.4
Csa06g02728 . 1 295 SNARE and Associated Proteins AT4G03330 54.5 2.7e-79 292.4
Csa06g02729 . 1 302 SNARE and Associated Proteins AT4G03330 53.3 3.0e-78 288.9
Csa03g04004 . 1 285 SNARE and Associated Proteins AT4G03330 50.2 3.1e-67 252.3
Csa01g01182 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 2.0e-127 452.2
Csa03g03501 . 1 279 SNARE and Associated Proteins AT1G61290 62.3 1.7e-89 326.2
Csa06g02729 . 1 284 SNARE and Associated Proteins AT1G61290 57.7 1.7e-81 299.7
Csa06g02728 . 1 301 SNARE and Associated Proteins AT1G61290 54.8 8.4e-81 297.4
Csa01g01182 . 1 299 SNARE and Associated Proteins AT1G11250 77.9 3.5e-124 441.4
Csa03g03501 . 1 279 SNARE and Associated Proteins AT1G11250 62.4 3.0e-91 332.0
Csa06g02729 . 1 284 SNARE and Associated Proteins AT1G11250 56.3 3.9e-83 305.1
Csa06g02728 . 1 284 SNARE and Associated Proteins AT1G11250 56.0 8.8e-83 303.9
Csa03g04004 . 1 309 SNARE and Associated Proteins AT3G03800 72.8 4.4e-114 407.9
Csa02g02691 . 1 305 SNARE and Associated Proteins AT3G03800 54.1 7.6e-82 300.8
Csa03g04004 . 1 203 SNARE and Associated Proteins AT5G08080 75.9 3.2e-77 285.0
Csa02g02691 . 1 204 SNARE and Associated Proteins AT5G08080 58.8 4.2e-53 204.9
Csa03g00149 . 174 365 SNARE and Associated Proteins AT1G32270 60.1 2.7e-51 199.5
Csa05g00800 . 1 218 SNARE and Associated Proteins AT5G05760 59.0 1.8e-60 229.9
Csa02g02340 . 479 810 SNARE and Associated Proteins AT3G24350 64.6 2.1e-102 369.4
Csa02g00478 . 1 327 SNARE and Associated Proteins AT5G26980 75.8 1.5e-125 446.0
Csa07g01878 . 1 318 SNARE and Associated Proteins AT5G26980 66.8 1.3e-103 373.2
Csa07g01878 . 1 318 SNARE and Associated Proteins AT4G02195 66.8 5.2e-105 377.9
Csa02g00478 . 1 330 SNARE and Associated Proteins AT4G02195 63.9 3.7e-103 371.7
Csa02g00478 . 1 328 SNARE and Associated Proteins AT3G05710 74.2 7.1e-126 447.2
Csa07g01878 . 1 321 SNARE and Associated Proteins AT3G05710 64.0 1.1e-99 360.1
Csa07g01013 . 1 234 SNARE and Associated Proteins AT1G16240 73.1 8.9e-91 330.1
Csa03g00456 . 1 234 SNARE and Associated Proteins AT1G16240 66.2 1.2e-79 293.1
Csa07g01013 . 1 234 SNARE and Associated Proteins AT1G79590 72.6 6.6e-90 327.4
Csa03g00456 . 1 234 SNARE and Associated Proteins AT1G79590 67.1 1.9e-81 299.3
Csa06g00630 . 56 247 SNARE and Associated Proteins AT1G28490 71.9 1.7e-66 249.2
Csa03g03265 . 1 264 SNARE and Associated Proteins AT3G09740 78.6 4.7e-112 401.0
Csa03g02736 . 1 264 SNARE and Associated Proteins AT3G09740 78.2 4.0e-111 397.9
Csa06g01683 . 1 267 SNARE and Associated Proteins AT3G09740 67.3 4.0e-95 344.7
Csa06g01683 . 1 267 SNARE and Associated Proteins AT3G45280 66.2 7.8e-91 330.5
Csa03g02736 . 1 264 SNARE and Associated Proteins AT3G45280 65.2 4.8e-88 321.2
Csa03g03265 . 1 264 SNARE and Associated Proteins AT3G45280 64.8 1.1e-87 320.1
Csa03g03265 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 6.7e-95 344.0
Csa03g02736 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 2.0e-94 342.4
Csa06g01683 . 1 263 SNARE and Associated Proteins AT3G61450 61.0 2.2e-85 312.4
Csa06g00159 . 47 291 SNARE and Associated Proteins AT1G51740 73.7 1.3e-92 336.3
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002038 1 2 1 1 1 2 3 2 2 2 2 2 3 3 2 3 2 2 3 2 3 2 2 2 2 2 3 2 2 2 63
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Csa06g01683 Csa_Chr06 FPKM 48.782005 53.268356 24.200163 23.621344 5.036555 4.199479 5.39423 21.213137 19.570429 18.703167