Gene search
Sequence information
| Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
|---|---|---|---|---|---|---|
| Csa06g02393 | ATGACAATCGACCATATGTCCGATCAAACACGCACTTCCACCAGCAATAACGATCATGATTCCGACCATCTCCATCCTACTCTTCCCACGCCACTTCTCTCCAATGGCACGGACTACAATAATGCTGGAGATGACCTCTTTGTTCCTCCCTTGAACTTCGCTGTCGTTGACACCGGCATTTTTCGCTCTGGTTTCCCTGACTCTTCCAACTTCTCTTTCTTGCAGACATTAGGCCTTCGGTCTATTATATGTCTTTGTCCCGAGCCATATCCTGAGGCTAGCATGGATTTCCTCAACTCCAATGGGATCCGATTGTTTCAATTTGGGATTGAAGGTTCTAAGGCTGGTTCAGACAAGGTTGATGCATATGTAAACTTGATTCTCGAGTGTATGAGGAATTTGGATATGAGCGCTGATCAAATGTACTTTTTGGAGCCTTTTGTCAACATTCCAGACTACACGATTCGTGAAGTACTTAAAATTATTCTTGATGTGAGGAATCGACCAGTTTTAATCCATTGCAAGCGAGGGAAGCACCGAACTGGATGTGTAGTGGGATGCTTTAGAAAGGTGCAGAAATGGTGCCTATCGTCAGTGTTTGATGAGTATCAGAGGTTTGCCGCTGCCAAGGCAAGAGTTTCAGATCAGAGATTCATTGAACTATTCGACATTTCTGAGTTGAAGCTTTTGCCATCATCATTTTCATGTTCCGAAAGATAA | 720 | 43.75 | MTIDHMSDQTRTSTSNNDHDSDHLHPTLPTPLLSNGTDYNNAGDDLFVPPLNFAVVDTGIFRSGFPDSSNFSFLQTLGLRSIICLCPEPYPEASMDFLNSNGIRLFQFGIEGSKAGSDKVDAYVNLILECMRNLDMSADQMYFLEPFVNIPDYTIREVLKIILDVRNRPVLIHCKRGKHRTGCVVGCFRKVQKWCLSSVFDEYQRFAAAKARVSDQRFIELFDISELKLLPSSFSCSER* | 240 |
Gff information
| Chromosome | Start | End | Strand | Old_gene | Gene | Num |
|---|---|---|---|---|---|---|
| 6 | 21388398 | 21391747 | - | CsaV3_6G037790.1 | Csa06g02393 | 534020 |
Annotation
| Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
|---|---|---|---|---|---|---|---|---|
| Csa06g02393 | 239 | MobiDBLite | consensus disorder prediction | 1 | 35 | - | - | |
| Csa06g02393 | 239 | CDD | PFA-DSP_Siw14 | 46 | 223 | - | - | |
| Csa06g02393 | 239 | Pfam | Tyrosine phosphatase family | 48 | 227 | IPR004861 | - | |
| Csa06g02393 | 239 | ProSitePatterns | Tyrosine specific protein phosphatases active site. | 172 | 182 | IPR016130 | GO:0016311|GO:0016791 | |
| Csa06g02393 | 239 | SUPERFAMILY | (Phosphotyrosine protein) phosphatases II | 47 | 224 | IPR029021 | - | |
| Csa06g02393 | 239 | ProSiteProfiles | Dual specificity protein phosphatase domain profile. | 52 | 236 | IPR020422 | GO:0006470|GO:0008138 | |
| Csa06g02393 | 239 | Gene3D | Protein tyrosine phosphatase superfamily | 46 | 226 | IPR029021 | - | |
| Csa06g02393 | 239 | PRINTS | Plant and fungal dual specificity phosphatase signature | 47 | 64 | IPR020428 | GO:0016791 | |
| Csa06g02393 | 239 | PRINTS | Plant and fungal dual specificity phosphatase signature | 84 | 97 | IPR020428 | GO:0016791 | |
| Csa06g02393 | 239 | PRINTS | Plant and fungal dual specificity phosphatase signature | 103 | 117 | IPR020428 | GO:0016791 | |
| Csa06g02393 | 239 | PRINTS | Plant and fungal dual specificity phosphatase signature | 150 | 164 | IPR020428 | GO:0016791 | |
| Csa06g02393 | 239 | PANTHER | TYROSINE-PROTEIN PHOSPHATASE | 1 | 238 | - | - | |
| Csa06g02393 | 239 | PANTHER | - | 1 | 238 | - | - |
Pathway
| Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
|---|---|---|---|---|---|---|
| Csa06g02393 | K18045 | SIW14, OCA3; tyrosine-protein phosphatase SIW14 [EC:3.1.3.48] | - | csv:101209768 | 407.527 |
Dupl-types
| Select | Gene1 | Location1 | Gene2 | Location2 | E-value | Duplicated-type |
|---|---|---|---|---|---|---|
| Csa01g03339 | Csa-Chr1:29942734 | Csa06g02393 | Csa-Chr6:21388398 | 2.35E-68 | dispersed | |
| Csa06g01343 | Csa-Chr6:11293158 | Csa06g02393 | Csa-Chr6:21388398 | 1.97E-95 | wgd |
Deco-Alignment
| Select | Vvi1 | Blo1 | Blo2 | Bda1 | Bda2 | Bpe1 | Bpe2 | Bma1 | Bma2 | Cmo1 | Cmo2 | Cma1 | Cma2 | Car1 | Car2 | Sed1 | Cpe1 | Cpe2 | Bhi1 | Tan1 | Cmetu1 | Lac1 | Hepe1 | Mch1 | Lcy1 | Cla1 | Cam1 | Cec1 | Cco1 | Clacu1 | Cmu1 | Cre1 | Cone1 | Cone2 | Cone3 | Cone4 | Lsi1 | Csa1 | Chy1 | Cme1 | Blo3 | Blo4 | Bda3 | Bda4 | Bpe3 | Bpe4 | Bma3 | Bma4 | Sed2 | Cmo3 | Cmo4 | Cma3 | Cma4 | Car3 | Car4 | Cpe3 | Cpe4 | Bhi2 | Tan2 | Cmetu2 | Lac2 | Hepe2 | Mch2 | Lcy2 | Cla2 | Cam2 | Cec2 | Cco2 | Clacu2 | Cmu2 | Cre2 | Lsi2 | Csa2 | Chy2 | Cme2 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Vvi12g443 | . | . | . | . | Bpe12g00275 | Bpe15g00169 | Bma03g01308 | Bma08g00533 | . | . | Cma02g00065 | Cma20g00235 | Car02g00052 | Car20g00205 | Sed05g1894 | . | . | Bhi05g02097 | Tan02g0134 | Cmetu05g0487 | . | . | . | . | Cla02g01771 | Cam02g1872 | Cec02g1896 | Cco02g1936 | Clacu02g1854 | Cmu02g1800 | . | . | Cone10ag1396 | Cone8ag1552 | . | Lsi10g01569 | . | Chy11g00950 | . | Blo04g01214 | Blo13g00337 | . | Bda15g00865 | Bpe14g00621 | . | . | . | Sed01g0708 | Cmo02g00063 | Cmo20g00254 | . | . | Car11g01620 | . | Cpe16g00749 | . | Bhi10g01060 | Tan05g0690 | Cmetu11g0212 | . | Hepe08g0587 | . | . | . | . | . | . | . | . | . | Lsi11g01669 | Csa06g02393 | . | Cme11g01505 |
Syn-Families
| Select | Gene | Event_type | S_start | S_end | Function | Ath_gene | Identity(%) | E-value | Score |
|---|---|---|---|---|---|---|---|---|---|
| Csa06g02964 | . | 33 | 608 | Protein tyrosine phosphatase (PTP) family | AT3G50110 | 63.0 | 2.8e-195 | 678.7 | |
| Csa07g00734 | . | 6 | 613 | Protein tyrosine phosphatase (PTP) family | AT3G50110 | 56.6 | 1.0e-181 | 633.6 | |
| Csa03g03804 | . | 1 | 407 | Protein tyrosine phosphatase (PTP) family | AT5G39400 | 65.7 | 1.1e-155 | 546.6 | |
| Csa02g02472 | . | 1 | 861 | Protein tyrosine phosphatase (PTP) family | AT3G10550 | 68.5 | 0.0e+00 | 1176.0 | |
| Csa02g02472 | . | 1 | 861 | Protein tyrosine phosphatase (PTP) family | AT5G04540 | 65.7 | 0.0e+00 | 1114.4 | |
| Csa01g01880 | . | 2 | 1214 | Protein tyrosine phosphatase (PTP) family | AT5G58160 | 52.7 | 2.2e-284 | 975.7 | |
| Csa01g01730 | . | 1 | 455 | Protein tyrosine phosphatase (PTP) family | AT5G58160 | 57.3 | 1.1e-150 | 531.6 | |
| Csa01g01729 | . | 87 | 256 | Protein tyrosine phosphatase (PTP) family | AT5G58160 | 67.1 | 7.8e-56 | 216.5 | |
| Csa07g01336 | . | 65 | 374 | Protein tyrosine phosphatase (PTP) family | AT1G71860 | 66.0 | 1.6e-117 | 419.5 | |
| Csa01g00011 | . | 7 | 913 | Protein tyrosine phosphatase (PTP) family | AT5G23720 | 64.4 | 0.0e+00 | 1085.1 | |
| Csa06g01564 | . | 33 | 171 | Protein tyrosine phosphatase (PTP) family | AT3G06110 | 55.7 | 1.4e-40 | 162.9 | |
| Csa06g02399 | . | 1 | 166 | Protein tyrosine phosphatase (PTP) family | AT2G04550 | 76.3 | 5.1e-70 | 260.8 | |
| Csa05g02758 | . | 96 | 376 | Protein tyrosine phosphatase (PTP) family | AT3G52180 | 68.3 | 1.2e-113 | 406.4 | |
| Csa05g00878 | . | 29 | 283 | Protein tyrosine phosphatase (PTP) family | AT3G10940 | 74.0 | 3.2e-111 | 398.3 | |
| Csa03g03940 | . | 151 | 599 | Protein tyrosine phosphatase (PTP) family | AT3G01510 | 71.9 | 2.0e-203 | 705.3 | |
| Csa06g01343 | . | 15 | 215 | Protein tyrosine phosphatase (PTP) family | AT2G32960 | 59.1 | 8.4e-74 | 273.9 | |
| Csa06g02393 | . | 43 | 240 | Protein tyrosine phosphatase (PTP) family | AT2G32960 | 62.9 | 6.2e-69 | 257.7 | |
| Csa01g03339 | . | 3 | 170 | Protein tyrosine phosphatase (PTP) family | AT2G32960 | 52.0 | 1.5e-54 | 209.9 | |
| Csa03g00252 | . | 1 | 335 | Protein tyrosine phosphatase (PTP) family | AT2G35680 | 55.6 | 7.3e-102 | 367.5 | |
| Csa02g00073 | . | 18 | 264 | Protein tyrosine phosphatase (PTP) family | AT2G35680 | 54.6 | 4.6e-80 | 295.0 | |
| Csa03g00252 | . | 38 | 213 | Protein tyrosine phosphatase (PTP) family | AT5G56610 | 51.7 | 1.0e-44 | 176.8 | |
| Csa06g01343 | . | 44 | 214 | Protein tyrosine phosphatase (PTP) family | AT4G03960 | 76.6 | 5.7e-78 | 287.3 | |
| Csa06g02393 | . | 41 | 239 | Protein tyrosine phosphatase (PTP) family | AT4G03960 | 61.3 | 2.2e-66 | 248.8 | |
| Csa01g03339 | . | 13 | 170 | Protein tyrosine phosphatase (PTP) family | AT4G03960 | 62.7 | 1.9e-57 | 219.2 | |
| Csa01g03339 | . | 3 | 201 | Protein tyrosine phosphatase (PTP) family | AT3G02800 | 69.7 | 2.8e-80 | 295.0 | |
| Csa06g01343 | . | 44 | 208 | Protein tyrosine phosphatase (PTP) family | AT3G02800 | 60.6 | 3.1e-55 | 211.8 | |
| Csa06g02393 | . | 37 | 228 | Protein tyrosine phosphatase (PTP) family | AT3G02800 | 50.5 | 8.7e-50 | 193.7 | |
| Csa05g00673 | . | 1 | 188 | Protein tyrosine phosphatase (PTP) family | AT3G55270 | 64.6 | 1.0e-61 | 235.3 | |
| Csa03g03804 | . | 1 | 407 | Protein tyrosine phosphatase (PTP) family | AT5G39400 | 65.7 | 1.1e-155 | 546.6 | |
| Csa07g00734 | . | 33 | 613 | Protein tyrosine phosphatase (PTP) family | AT3G19420 | 65.8 | 2.4e-220 | 761.9 | |
| Csa06g02964 | . | 31 | 608 | Protein tyrosine phosphatase (PTP) family | AT3G19420 | 62.6 | 9.9e-198 | 686.8 | |
| Csa06g02964 | . | 33 | 608 | Protein tyrosine phosphatase (PTP) family | AT3G50110 | 63.0 | 2.8e-195 | 678.7 | |
| Csa07g00734 | . | 6 | 613 | Protein tyrosine phosphatase (PTP) family | AT3G50110 | 56.6 | 1.0e-181 | 633.6 | |
| Csa01g01880 | . | 2 | 1214 | Protein tyrosine phosphatase (PTP) family | AT5G58160 | 52.7 | 2.2e-284 | 975.7 | |
| Csa01g01730 | . | 1 | 455 | Protein tyrosine phosphatase (PTP) family | AT5G58160 | 57.3 | 1.1e-150 | 531.6 | |
| Csa01g01729 | . | 87 | 256 | Protein tyrosine phosphatase (PTP) family | AT5G58160 | 67.1 | 7.8e-56 | 216.5 | |
| Csa02g02472 | . | 1 | 861 | Protein tyrosine phosphatase (PTP) family | AT3G10550 | 68.5 | 0.0e+00 | 1176.0 | |
| Csa02g02472 | . | 1 | 861 | Protein tyrosine phosphatase (PTP) family | AT5G04540 | 65.7 | 0.0e+00 | 1114.4 | |
| Csa06g01286 | . | 17 | 244 | Protein tyrosine phosphatase (PTP) family | AT3G44620 | 57.6 | 8.9e-71 | 263.8 | |
| Csa03g00186 | . | 19 | 303 | Protein tyrosine phosphatase (PTP) family | AT2G35320 | 64.9 | 1.5e-109 | 392.9 | |
| Csa04g01589 | . | 1 | 673 | Protein tyrosine phosphatase (PTP) family | AT3G09100 | 68.5 | 3.4e-276 | 947.6 | |
| Csa04g01589 | . | 5 | 673 | Protein tyrosine phosphatase (PTP) family | AT5G01290 | 65.4 | 1.3e-251 | 865.9 | |
| Csa04g01589 | . | 86 | 673 | Protein tyrosine phosphatase (PTP) family | AT5G28210 | 56.3 | 1.8e-183 | 639.4 |
Syn-Orthogroups
| Select | Orthogroup | Bda | Bhi | Blo | Bma | Bpe | Cam | Car | Cco | Cec | Chy | Cla | Clacu | Cma | Cme | Cmetu | Cmo | Cmu | Cone | Cpe | Cre | Csa | HCH | Hepe | Lac | Lcy | Lsi | Mch | Sed | Tan | Vvi | Total |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| OG0001007 | 2 | 3 | 3 | 4 | 3 | 2 | 4 | 2 | 2 | 2 | 2 | 2 | 4 | 2 | 2 | 4 | 2 | 4 | 4 | 1 | 2 | 2 | 2 | 2 | 2 | 2 | 2 | 7 | 6 | 2 | 83 |