Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Csa06g02728 ATGAACGATCTGTTTTCCACCGATTCCTTCCGCCAAGAGCATCACCAATATCGCCACCATGACACCGTCGAGATGTCCGACAACTTGCCGTCCTCAACCACGATCAATCTCAACACCTTCTTCGACGACGTGGAGTCGGTCAAGGCGGAATTAACAGAACTCGAAGGGCTCCACCGAAGCCTCCAGAATTCTCACGAACAGAGCAAAACTCTACACAATTCCAAGGCGATTAAGGATGTTCGATCGCGAATGGAGACGGCTGTGACATTGGCTTTGAAGAAGGCTAGGTTTATCAAGGTCCGGCTGGAGGAACTGGACCGGTCGAATGAGGAGAACCGGAAGCTTCCTGGTTGTGGGTATGGATCCTCGGCGGACCGGTCGAGAACATCGGTGGTGAGCGGATTGAGGAAGAAGCTGTGTGATTCAATGGAGAGTTTTAACAGATTGAGAGAAGAGATAACGAAGACGTATAAGGAGACGATTGAACGGAGGTATTTTACAATTACAGGGGAAAATCCGGATGAGAAGACTGTTGAATTGTTGATCTCTACAGGTGAAAGTGAAACGTTCTTGCAAAAAGCAATACAAAAGCAAGGAAGAGGAAGAGTTCTGGAAACAATCCAAGAGATTCAAGAAAGGCACGACGCAGTGAAAGACATAGAGAGGAATTTGAGAGAGTTGCACCAAGTTTTCTTGGACATGGCGGTTATGGTTCAAGCACAGGGGCAGCAGTTAGACGACATCGAAAGCCAAGTTACTCGAGCCAACTCTGCTGTCAAGCGGGGCACGTCTCAGCTACAAACTGCAAGGTACTATCAAAAAAACACTCGCAAATGGATCTGCATAGGCGTCAGTGTTGGTGCTACAGTCATTCTCATCATTATAATCGTTGCTATCGCCCGCGCGATAAAGAAAAAGGATGGTTAG 927 47.57 MNDLFSTDSFRQEHHQYRHHDTVEMSDNLPSSTTINLNTFFDDVESVKAELTELEGLHRSLQNSHEQSKTLHNSKAIKDVRSRMETAVTLALKKARFIKVRLEELDRSNEENRKLPGCGYGSSADRSRTSVVSGLRKKLCDSMESFNRLREEITKTYKETIERRYFTITGENPDEKTVELLISTGESETFLQKAIQKQGRGRVLETIQEIQERHDAVKDIERNLRELHQVFLDMAVMVQAQGQQLDDIESQVTRANSAVKRGTSQLQTARYYQKNTRKWICIGVSVGATVILIIIIVAIARAIKKKDG* 309
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
6 23853120 23854314 + CsaV3_6G041140.1 Csa06g02728 534355

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Csa06g02728 308 CDD SNARE_syntaxin1-like 206 268 - -
Csa06g02728 308 SMART tSNARE_6 202 269 IPR000727 -
Csa06g02728 308 Coils Coil 44 64 - -
Csa06g02728 308 CDD SynN 40 194 IPR006011 GO:0016020
Csa06g02728 308 Gene3D - 202 303 - -
Csa06g02728 308 SUPERFAMILY t-snare proteins 36 262 IPR010989 GO:0016020|GO:0016192
Csa06g02728 308 SMART SynN_4 32 158 IPR006011 GO:0016020
Csa06g02728 308 Gene3D - 37 164 - -
Csa06g02728 308 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 207 269 IPR000727 -
Csa06g02728 308 PANTHER SYNTAXIN 15 297 IPR045242 -
Csa06g02728 308 Pfam Syntaxin 40 242 IPR006011 GO:0016020
Csa06g02728 308 Pfam SNARE domain 244 295 IPR000727 -
Csa06g02728 308 PANTHER SYNTAXIN-121 15 297 - -
Csa06g02728 308 ProSitePatterns Syntaxin / epimorphin family signature. 213 252 IPR006012 GO:0005484|GO:0006886|GO:0016020
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Csa06g02728 K08486 STX1B_2_3; syntaxin 1B/2/3 - csv:101213199 584.334
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Csa01g01182 Csa-Chr1:7322149 Csa06g02728 Csa-Chr6:23853120 2.44E-115 dispersed
Csa06g02728 Csa-Chr6:23853120 Csa06g03248 Csa-Chr6:27399246 2.75E-54 dispersed
Csa06g02728 Csa-Chr6:23853120 Csa06g02729 Csa-Chr6:23857036 0 tandem
Csa03g04004 Csa-Chr3:34985908 Csa06g02728 Csa-Chr6:23853120 1.05E-89 transposed
Csa03g03501 Csa-Chr3:31360235 Csa06g02728 Csa-Chr6:23853120 4.57E-145 wgd
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Csa02g02340 . 479 810 SNARE and Associated Proteins AT3G24350 64.6 2.1e-102 369.4
Csa04g01137 . 1 310 SNARE and Associated Proteins AT1G08560 67.9 9.7e-101 363.6
Csa06g03248 . 1 303 SNARE and Associated Proteins AT2G18260 54.2 2.8e-84 308.9
Csa03g03501 . 22 279 SNARE and Associated Proteins AT3G11820 80.6 1.0e-113 406.8
Csa06g02729 . 25 284 SNARE and Associated Proteins AT3G11820 70.4 8.4e-100 360.5
Csa06g02728 . 25 284 SNARE and Associated Proteins AT3G11820 69.6 4.1e-99 358.2
Csa01g01182 . 26 281 SNARE and Associated Proteins AT3G11820 65.0 1.4e-91 333.2
Csa03g04004 . 26 285 SNARE and Associated Proteins AT3G11820 51.2 1.2e-66 250.4
Csa03g03501 . 31 279 SNARE and Associated Proteins AT3G52400 69.5 1.7e-90 329.7
Csa06g02729 . 19 284 SNARE and Associated Proteins AT3G52400 63.0 1.7e-85 313.2
Csa06g02728 . 36 284 SNARE and Associated Proteins AT3G52400 65.5 8.2e-85 310.8
Csa01g01182 . 1 281 SNARE and Associated Proteins AT3G52400 56.0 1.6e-80 296.6
Csa01g01182 . 1 299 SNARE and Associated Proteins AT4G03330 67.2 2.0e-106 382.5
Csa03g03501 . 1 278 SNARE and Associated Proteins AT4G03330 57.2 9.9e-82 300.4
Csa06g02728 . 1 295 SNARE and Associated Proteins AT4G03330 54.5 2.7e-79 292.4
Csa06g02729 . 1 302 SNARE and Associated Proteins AT4G03330 53.3 3.0e-78 288.9
Csa03g04004 . 1 285 SNARE and Associated Proteins AT4G03330 50.2 3.1e-67 252.3
Csa01g01182 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 2.0e-127 452.2
Csa03g03501 . 1 279 SNARE and Associated Proteins AT1G61290 62.3 1.7e-89 326.2
Csa06g02729 . 1 284 SNARE and Associated Proteins AT1G61290 57.7 1.7e-81 299.7
Csa06g02728 . 1 301 SNARE and Associated Proteins AT1G61290 54.8 8.4e-81 297.4
Csa01g01182 . 1 299 SNARE and Associated Proteins AT1G11250 77.9 3.5e-124 441.4
Csa03g03501 . 1 279 SNARE and Associated Proteins AT1G11250 62.4 3.0e-91 332.0
Csa06g02729 . 1 284 SNARE and Associated Proteins AT1G11250 56.3 3.9e-83 305.1
Csa06g02728 . 1 284 SNARE and Associated Proteins AT1G11250 56.0 8.8e-83 303.9
Csa03g04004 . 1 309 SNARE and Associated Proteins AT3G03800 72.8 4.4e-114 407.9
Csa02g02691 . 1 305 SNARE and Associated Proteins AT3G03800 54.1 7.6e-82 300.8
Csa03g04004 . 1 203 SNARE and Associated Proteins AT5G08080 75.9 3.2e-77 285.0
Csa02g02691 . 1 204 SNARE and Associated Proteins AT5G08080 58.8 4.2e-53 204.9
Csa03g00149 . 174 365 SNARE and Associated Proteins AT1G32270 60.1 2.7e-51 199.5
Csa05g00800 . 1 218 SNARE and Associated Proteins AT5G05760 59.0 1.8e-60 229.9
Csa02g02340 . 479 810 SNARE and Associated Proteins AT3G24350 64.6 2.1e-102 369.4
Csa02g00478 . 1 327 SNARE and Associated Proteins AT5G26980 75.8 1.5e-125 446.0
Csa07g01878 . 1 318 SNARE and Associated Proteins AT5G26980 66.8 1.3e-103 373.2
Csa07g01878 . 1 318 SNARE and Associated Proteins AT4G02195 66.8 5.2e-105 377.9
Csa02g00478 . 1 330 SNARE and Associated Proteins AT4G02195 63.9 3.7e-103 371.7
Csa02g00478 . 1 328 SNARE and Associated Proteins AT3G05710 74.2 7.1e-126 447.2
Csa07g01878 . 1 321 SNARE and Associated Proteins AT3G05710 64.0 1.1e-99 360.1
Csa07g01013 . 1 234 SNARE and Associated Proteins AT1G16240 73.1 8.9e-91 330.1
Csa03g00456 . 1 234 SNARE and Associated Proteins AT1G16240 66.2 1.2e-79 293.1
Csa07g01013 . 1 234 SNARE and Associated Proteins AT1G79590 72.6 6.6e-90 327.4
Csa03g00456 . 1 234 SNARE and Associated Proteins AT1G79590 67.1 1.9e-81 299.3
Csa06g00630 . 56 247 SNARE and Associated Proteins AT1G28490 71.9 1.7e-66 249.2
Csa03g03265 . 1 264 SNARE and Associated Proteins AT3G09740 78.6 4.7e-112 401.0
Csa03g02736 . 1 264 SNARE and Associated Proteins AT3G09740 78.2 4.0e-111 397.9
Csa06g01683 . 1 267 SNARE and Associated Proteins AT3G09740 67.3 4.0e-95 344.7
Csa06g01683 . 1 267 SNARE and Associated Proteins AT3G45280 66.2 7.8e-91 330.5
Csa03g02736 . 1 264 SNARE and Associated Proteins AT3G45280 65.2 4.8e-88 321.2
Csa03g03265 . 1 264 SNARE and Associated Proteins AT3G45280 64.8 1.1e-87 320.1
Csa03g03265 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 6.7e-95 344.0
Csa03g02736 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 2.0e-94 342.4
Csa06g01683 . 1 263 SNARE and Associated Proteins AT3G61450 61.0 2.2e-85 312.4
Csa06g00159 . 47 291 SNARE and Associated Proteins AT1G51740 73.7 1.3e-92 336.3
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002313 5 3 2 3 3 1 2 1 1 2 1 2 2 2 2 2 2 2 3 1 3 2 2 2 3 1 2 3 2 0 62