Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
HCH2g0914 ATGGCTGCTTCATCAATGGCTCTCTCTTCCCCTTCTCTCGCCGGCCAAGCCGTCAAGTTGGCGCCCTCTGCATCTGACCTCCTCGGTGAAGGCCGTGTCACCATGAGGAAAACTGCCAGCAAACCAAAAACAGTCTCATCTGGAAGCCCATGGTATGGCCCTGACCGTGTTAAGTACTTGGGTCCATTCTCTGGTGAATCTCCCTCCTATCTCACCGGAGAATTCCCAGGTGACTATGGCTGGGACACCGCCGGTCTCTCGGCCGACCCTGAGACCTTTGCTAAAAACCGGGAGCTTGAAGTGATCCACTCAAGATGGGCCATGCTTGGAGCTTTGGGTTGTGTCTTTCCGGAGCTTCTCTCCCGCAACGGAGTCAAGTTCGGGGAAGCCGTGTGGTTCAAAGCTGGATCCCAAATCTTCAGTGAAGGAGGACTTGACTATTTGGGCAACCCAAGCTTAGTCCATGCTCAGAGCATTTTGGCCATATGGGCAACTCAGGTTGTCTTGATGGGTGCAGTTGAGGGCTACAGAATTGCCGGCGGGCCTCTCGGTGAGATCACCGACCCAATCTACCCGGGTGGAAGCTTTGATCCTTTGGGACTTGCTGATGACCCAGAGGCTTTCGCCGAGCTTAAGGTAAAAGAGCTCAAGAATGGAAGATTAGCCATGTTTTCCGTGTTTGGATTCTTTGTACAAGCCATTGTGACTGGAAAGGGACCTTTGGAAAATTTGGCCGATCACTTGGCTGATCCTGTGAACAACAACGCATGGGCTTATGCCACAAACTTTGCCCCTGGAAAGTGA 804 52.61 MAASSMALSSPSLAGQAVKLAPSASDLLGEGRVTMRKTASKPKTVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSVFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFAPGK 267
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
2 52589627 52590430 - evm.model.ptg000010l.590 HCH2g0914 540139

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
HCH2g0914 267 Gene3D Chlorophyll a/b binding protein domain 58 260 - -
HCH2g0914 267 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 4 267 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0009941(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
HCH2g0914 267 SUPERFAMILY Chlorophyll a-b binding protein 50 264 - -
HCH2g0914 267 Pfam Chlorophyll A-B binding protein 68 234 IPR022796 -
HCH2g0914 267 FunFam Chlorophyll a-b binding protein, chloroplastic 58 260 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
HCH2g0914 K08912 - - csv:101213845 525.398
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
HCH2g0912 HCH-Chr2:52583806 HCH2g0914 HCH-Chr2:52589627 1.40E-153 dispersed
HCH2g0914 HCH-Chr2:52589627 HCH3g0785 HCH-Chr3:5738655 1.10E-145 dispersed
HCH2g0913 HCH-Chr2:52586840 HCH2g0914 HCH-Chr2:52589627 4.90E-154 tandem
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
HCH3g1344 . 1 446 Chloroplast and Mitochondria Gene Families AT2G28800 63.7 5.9e-141 497.7
HCH4g0073 . 68 403 Chloroplast and Mitochondria Gene Families AT2G28800 57.2 1.3e-98 357.1
HCH4g1874 . 1 253 Chloroplast and Mitochondria Gene Families AT1G15820 79.8 4.2e-118 421.0
HCH7g0335 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 90.6 6.8e-144 506.9
HCH3g0786 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.9 1.0e-120 429.9
HCH2g0909 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 77.4 1.8e-120 429.1
HCH2g0911 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 77.4 1.8e-120 429.1
HCH3g0782 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.9 1.8e-120 429.1
HCH3g0785 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 78.6 1.8e-120 429.1
HCH3g0790 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 78.2 4.0e-120 427.9
HCH2g0912 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 5.2e-120 427.6
HCH3g0788 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.5 5.2e-120 427.6
HCH2g0910 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 6.8e-120 427.2
HCH3g0783 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.5 8.9e-120 426.8
HCH2g0913 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 76.6 1.5e-119 426.0
HCH2g0914 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 76.6 1.5e-119 426.0
HCH14g1047 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.4 2.0e-119 425.6
HCH6g0408 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 78.0 2.0e-119 425.6
HCH14g1048 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 5.8e-119 424.1
HCH3g0787 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.4 1.7e-118 422.5
HCH3g0789 . 1 231 Chloroplast and Mitochondria Gene Families AT3G27690 84.0 5.0e-115 411.0
HCH12g1114 . 3 269 Chloroplast and Mitochondria Gene Families AT3G27690 68.8 1.3e-99 359.8
HCH6g0711 . 5 273 Chloroplast and Mitochondria Gene Families AT3G27690 65.6 1.6e-97 352.8
HCH12g1628 . 71 260 Chloroplast and Mitochondria Gene Families AT3G27690 50.8 1.1e-45 180.6
HCH1g1146 . 6 267 Chloroplast and Mitochondria Gene Families AT3G61470 81.0 1.0e-127 453.0
HCH8g0587 . 53 258 Chloroplast and Mitochondria Gene Families AT3G61470 66.5 1.2e-83 306.6
HCH8g1293 . 22 250 Chloroplast and Mitochondria Gene Families AT3G61470 50.6 2.7e-64 242.3
HCH13g0405 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 80.4 1.7e-88 322.4
HCH11g0096 . 1 287 Chloroplast and Mitochondria Gene Families AT3G08940 83.3 6.5e-136 480.3
HCH9g0770 . 4 283 Chloroplast and Mitochondria Gene Families AT3G08940 83.6 4.2e-135 477.6
HCH12g0020 . 6 330 Chloroplast and Mitochondria Gene Families AT1G76570 71.9 1.4e-137 486.1
HCH8g0373 . 1 273 Chloroplast and Mitochondria Gene Families AT1G61520 86.8 9.6e-137 483.0
HCH7g0335 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.8 3.0e-143 504.6
HCH2g0909 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 79.0 5.5e-121 430.6
HCH2g0911 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 79.0 5.5e-121 430.6
HCH3g0786 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 5.5e-121 430.6
HCH3g0782 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 9.3e-121 429.9
HCH3g0785 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 79.7 9.3e-121 429.9
HCH2g0912 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.7 1.6e-120 429.1
HCH2g0910 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.7 2.1e-120 428.7
HCH3g0790 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 79.3 2.1e-120 428.7
HCH3g0788 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 2.7e-120 428.3
HCH2g0913 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.3 4.6e-120 427.6
HCH2g0914 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.3 4.6e-120 427.6
HCH3g0783 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 4.6e-120 427.6
HCH14g1047 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 1.8e-119 425.6
HCH14g1048 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.2 5.1e-119 424.1
HCH6g0408 . 8 265 Chloroplast and Mitochondria Gene Families AT2G05070 79.9 6.7e-119 423.7
HCH3g0787 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 77.4 8.7e-119 423.3
HCH3g0789 . 1 231 Chloroplast and Mitochondria Gene Families AT2G05070 84.0 5.9e-115 410.6
HCH12g1114 . 13 269 Chloroplast and Mitochondria Gene Families AT2G05070 68.4 1.3e-98 356.3
HCH6g0711 . 8 273 Chloroplast and Mitochondria Gene Families AT2G05070 67.2 6.1e-96 347.4
HCH12g1628 . 71 260 Chloroplast and Mitochondria Gene Families AT2G05070 50.8 1.3e-45 180.3
HCH7g0335 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 90.3 2.6e-125 445.3
HCH2g0909 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 77.5 4.0e-102 368.2
HCH2g0911 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 77.5 4.0e-102 368.2
HCH3g0786 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.5 6.8e-102 367.5
HCH2g0912 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 77.1 1.2e-101 366.7
HCH2g0913 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 77.1 1.2e-101 366.7
HCH2g0914 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 77.1 1.2e-101 366.7
HCH3g0782 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.5 1.2e-101 366.7
HCH3g0785 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.3 1.2e-101 366.7
HCH3g0788 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.5 1.2e-101 366.7
HCH2g0910 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 77.1 1.5e-101 366.3
HCH3g0790 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 2.6e-101 365.5
HCH3g0783 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.1 5.8e-101 364.4
HCH14g1047 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 7.5e-101 364.0
HCH6g0408 . 27 237 Chloroplast and Mitochondria Gene Families AT2G05100 83.4 9.8e-101 363.6
HCH14g1048 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.5 2.2e-100 362.5
HCH3g0787 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.2 3.7e-100 361.7
HCH3g0789 . 1 203 Chloroplast and Mitochondria Gene Families AT2G05100 82.8 8.6e-97 350.5
HCH12g1114 . 13 241 Chloroplast and Mitochondria Gene Families AT2G05100 68.5 1.9e-83 306.2
HCH6g0711 . 8 245 Chloroplast and Mitochondria Gene Families AT2G05100 66.7 5.1e-81 298.1
HCH12g1628 . 71 258 Chloroplast and Mitochondria Gene Families AT2G05100 50.8 3.8e-44 175.6
HCH11g0096 . 4 169 Chloroplast and Mitochondria Gene Families AT2G40100 67.3 2.1e-63 238.8
HCH9g0770 . 4 165 Chloroplast and Mitochondria Gene Families AT2G40100 71.4 2.1e-63 238.8
HCH2g0909 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 89.6 2.9e-138 488.0
HCH2g0910 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 89.6 2.9e-138 488.0
HCH2g0911 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 89.6 2.9e-138 488.0
HCH2g0912 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 89.2 8.5e-138 486.5
HCH2g0913 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 2.5e-137 485.0
HCH2g0914 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 2.5e-137 485.0
HCH3g0788 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 89.1 9.4e-137 483.0
HCH3g0782 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 1.6e-136 482.3
HCH3g0785 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 2.7e-136 481.5
HCH3g0786 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.0 6.1e-136 480.3
HCH3g0783 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 1.0e-135 479.6
HCH14g1047 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.0 6.7e-135 476.9
HCH3g0790 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 87.6 6.7e-135 476.9
HCH3g0787 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 87.6 8.8e-135 476.5
HCH14g1048 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 87.6 2.0e-134 475.3
HCH6g0408 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29930 86.8 1.4e-129 459.1
HCH3g0789 . 1 231 Chloroplast and Mitochondria Gene Families AT1G29930 89.3 1.9e-121 432.2
HCH7g0335 . 30 265 Chloroplast and Mitochondria Gene Families AT1G29930 82.9 1.1e-116 416.4
HCH12g1114 . 51 269 Chloroplast and Mitochondria Gene Families AT1G29930 75.5 1.2e-94 343.2
HCH6g0711 . 55 273 Chloroplast and Mitochondria Gene Families AT1G29930 75.0 5.7e-94 340.9
HCH2g0909 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 89.2 1.1e-137 486.1
HCH2g0910 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 89.2 1.1e-137 486.1
HCH2g0911 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 89.2 1.1e-137 486.1
HCH2g0912 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 88.8 3.2e-137 484.6
HCH2g0913 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 9.4e-137 483.0
HCH2g0914 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 9.4e-137 483.0
HCH3g0788 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.8 3.6e-136 481.1
HCH3g0782 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 6.1e-136 480.3
HCH3g0785 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 1.0e-135 479.6
HCH3g0786 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.6 2.3e-135 478.4
HCH3g0783 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.0 3.9e-135 477.6
HCH14g1047 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.6 2.5e-134 474.9
HCH3g0790 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.3 2.5e-134 474.9
HCH3g0787 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.3 3.3e-134 474.6
HCH14g1048 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.3 7.4e-134 473.4
HCH6g0408 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29920 86.8 1.9e-129 458.8
HCH3g0789 . 1 231 Chloroplast and Mitochondria Gene Families AT1G29920 89.3 1.9e-121 432.2
HCH7g0335 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29920 77.5 6.3e-117 417.2
HCH12g1114 . 51 269 Chloroplast and Mitochondria Gene Families AT1G29920 75.5 1.2e-94 343.2
HCH6g0711 . 55 273 Chloroplast and Mitochondria Gene Families AT1G29920 75.0 5.7e-94 340.9
HCH2g0909 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 89.2 1.1e-137 486.1
HCH2g0910 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 89.2 1.1e-137 486.1
HCH2g0911 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 89.2 1.1e-137 486.1
HCH2g0912 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 88.8 3.2e-137 484.6
HCH2g0913 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 9.4e-137 483.0
HCH2g0914 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 9.4e-137 483.0
HCH3g0788 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.8 3.6e-136 481.1
HCH3g0782 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 6.1e-136 480.3
HCH3g0785 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 1.0e-135 479.6
HCH3g0786 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.6 2.3e-135 478.4
HCH3g0783 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.0 3.9e-135 477.6
HCH14g1047 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.6 2.5e-134 474.9
HCH3g0790 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.3 2.5e-134 474.9
HCH3g0787 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.3 3.3e-134 474.6
HCH14g1048 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.3 7.4e-134 473.4
HCH6g0408 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29910 86.8 1.9e-129 458.8
HCH3g0789 . 1 231 Chloroplast and Mitochondria Gene Families AT1G29910 89.3 1.9e-121 432.2
HCH7g0335 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29910 77.5 6.3e-117 417.2
HCH12g1114 . 51 269 Chloroplast and Mitochondria Gene Families AT1G29910 75.5 1.2e-94 343.2
HCH6g0711 . 55 273 Chloroplast and Mitochondria Gene Families AT1G29910 75.0 5.7e-94 340.9
HCH12g1628 . 11 260 Chloroplast and Mitochondria Gene Families AT4G10340 84.1 2.2e-120 428.7
HCH3g0788 . 40 253 Chloroplast and Mitochondria Gene Families AT4G10340 53.2 3.5e-57 218.8
HCH2g0909 . 40 255 Chloroplast and Mitochondria Gene Families AT4G10340 52.7 4.5e-57 218.4
HCH2g0910 . 41 255 Chloroplast and Mitochondria Gene Families AT4G10340 52.9 4.5e-57 218.4
HCH2g0911 . 40 255 Chloroplast and Mitochondria Gene Families AT4G10340 52.7 4.5e-57 218.4
HCH3g0782 . 40 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.7 5.9e-57 218.0
HCH3g0790 . 40 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.7 5.9e-57 218.0
HCH14g1047 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 51.6 7.7e-57 217.6
HCH14g1048 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 51.6 7.7e-57 217.6
HCH3g0785 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 7.7e-57 217.6
HCH6g0408 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 7.7e-57 217.6
HCH3g0786 . 40 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.3 1.0e-56 217.2
HCH2g0912 . 40 255 Chloroplast and Mitochondria Gene Families AT4G10340 52.2 1.3e-56 216.9
HCH2g0913 . 40 255 Chloroplast and Mitochondria Gene Families AT4G10340 52.2 1.3e-56 216.9
HCH2g0914 . 40 255 Chloroplast and Mitochondria Gene Families AT4G10340 52.2 1.3e-56 216.9
HCH3g0789 . 15 219 Chloroplast and Mitochondria Gene Families AT4G10340 54.5 1.3e-56 216.9
HCH3g0787 . 40 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.3 1.7e-56 216.5
HCH3g0783 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 51.6 2.9e-56 215.7
HCH7g0335 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 9.4e-55 210.7
HCH12g1114 . 51 257 Chloroplast and Mitochondria Gene Families AT4G10340 53.3 2.0e-52 203.0
HCH6g0711 . 55 261 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 3.7e-51 198.7
HCH2g0909 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 89.2 2.7e-136 481.5
HCH2g0910 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 89.2 2.7e-136 481.5
HCH2g0911 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 89.2 2.7e-136 481.5
HCH2g0912 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 88.8 7.9e-136 479.9
HCH2g0913 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 2.3e-135 478.4
HCH2g0914 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 2.3e-135 478.4
HCH3g0788 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.8 8.7e-135 476.5
HCH3g0782 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 1.5e-134 475.7
HCH3g0785 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 2.5e-134 474.9
HCH3g0786 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 5.6e-134 473.8
HCH3g0783 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.0 9.6e-134 473.0
HCH14g1047 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.3 2.8e-133 471.5
HCH14g1048 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.3 2.8e-133 471.5
HCH3g0790 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.3 6.2e-133 470.3
HCH3g0787 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.3 8.1e-133 469.9
HCH6g0408 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34420 86.4 9.3e-129 456.4
HCH3g0789 . 1 231 Chloroplast and Mitochondria Gene Families AT2G34420 89.7 1.1e-121 433.0
HCH7g0335 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 76.8 2.2e-117 418.7
HCH12g1114 . 51 269 Chloroplast and Mitochondria Gene Families AT2G34420 75.9 1.5e-94 342.8
HCH6g0711 . 55 273 Chloroplast and Mitochondria Gene Families AT2G34420 75.5 7.4e-94 340.5
HCH3g0788 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.7 4.2e-137 484.2
HCH3g0782 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 7.1e-137 483.4
HCH3g0785 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 1.2e-136 482.6
HCH2g0909 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 89.2 2.7e-136 481.5
HCH2g0911 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 89.2 2.7e-136 481.5
HCH3g0786 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 2.7e-136 481.5
HCH2g0910 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 88.8 4.6e-136 480.7
HCH2g0912 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 88.8 7.9e-136 479.9
HCH3g0790 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 1.0e-135 479.6
HCH3g0783 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 1.8e-135 478.8
HCH2g0913 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 88.4 2.3e-135 478.4
HCH2g0914 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 88.4 2.3e-135 478.4
HCH3g0787 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.2 3.9e-135 477.6
HCH14g1047 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.2 5.1e-135 477.2
HCH14g1048 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 86.8 1.5e-134 475.7
HCH6g0408 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34430 86.4 5.0e-130 460.7
HCH3g0789 . 1 231 Chloroplast and Mitochondria Gene Families AT2G34430 89.7 2.9e-122 434.9
HCH7g0335 . 31 265 Chloroplast and Mitochondria Gene Families AT2G34430 82.8 4.5e-115 411.0
HCH6g0711 . 34 273 Chloroplast and Mitochondria Gene Families AT2G34430 71.0 1.5e-94 342.8
HCH12g1114 . 51 269 Chloroplast and Mitochondria Gene Families AT2G34430 75.9 2.0e-94 342.4
HCH11g0096 . 3 287 Chloroplast and Mitochondria Gene Families AT5G01530 84.0 8.3e-139 490.0
HCH9g0770 . 2 283 Chloroplast and Mitochondria Gene Families AT5G01530 82.8 5.0e-136 480.7
HCH11g0755 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.8 6.5e-143 503.4
HCH11g0755 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 85.5 1.7e-150 528.9
HCH2g0996 . 5 318 Chloroplast and Mitochondria Gene Families AT2G30160 73.4 7.3e-139 490.3
HCH9g0795 . 17 315 Chloroplast and Mitochondria Gene Families AT2G30160 67.0 2.3e-116 415.6
HCH2g0996 . 5 318 Chloroplast and Mitochondria Gene Families AT1G07030 74.8 2.5e-139 491.9
HCH9g0795 . 17 315 Chloroplast and Mitochondria Gene Families AT1G07030 68.7 7.4e-120 427.2
HCH4g1046 . 4 306 Chloroplast and Mitochondria Gene Families AT2G47490 77.9 5.8e-138 487.3
HCH10g1285 . 9 310 Chloroplast and Mitochondria Gene Families AT2G47490 62.4 8.2e-108 387.1
HCH10g1285 . 8 348 Chloroplast and Mitochondria Gene Families AT1G25380 64.6 5.7e-121 431.0
HCH4g1046 . 17 298 Chloroplast and Mitochondria Gene Families AT1G25380 63.2 2.9e-104 375.6
HCH3g0606 . 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 73.7 2.6e-256 881.3
HCH2g0788 . 1 583 Chloroplast and Mitochondria Gene Families AT4G21490 68.9 5.4e-238 820.5
HCH7g0181 . 1 575 Chloroplast and Mitochondria Gene Families AT4G21490 64.9 3.7e-223 771.2
HCH4g1494 . 15 186 Chloroplast and Mitochondria Gene Families AT1G17530 66.5 5.2e-62 234.2
HCH8g0184 . 8 178 Chloroplast and Mitochondria Gene Families AT1G17530 59.0 2.2e-52 202.2
HCH8g0184 . 10 182 Chloroplast and Mitochondria Gene Families AT3G04800 59.2 2.9e-52 201.8
HCH4g1494 . 20 190 Chloroplast and Mitochondria Gene Families AT3G04800 53.8 9.5e-43 170.2
HCH4g1494 . 13 190 Chloroplast and Mitochondria Gene Families AT1G72750 68.9 8.8e-65 243.4
HCH8g0184 . 8 182 Chloroplast and Mitochondria Gene Families AT1G72750 59.6 1.4e-54 209.5
HCH1g0812 . 1 223 Chloroplast and Mitochondria Gene Families AT1G26100 61.0 1.0e-70 263.5
HCH13g0619 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 74.9 2.6e-95 345.1
HCH5g0799 . 23 233 Chloroplast and Mitochondria Gene Families AT4G25570 65.9 2.9e-80 295.4
HCH10g1383 . 5 223 Chloroplast and Mitochondria Gene Families AT1G14730 54.3 1.2e-65 246.5
HCH10g1107 . 9 361 Chloroplast and Mitochondria Gene Families AT5G14040 81.0 3.4e-169 591.3
HCH9g0028 . 45 390 Chloroplast and Mitochondria Gene Families AT5G14040 75.4 6.9e-154 540.4
HCH7g0391 . 20 315 Chloroplast and Mitochondria Gene Families AT5G14040 52.3 1.5e-87 320.1
HCH10g1107 . 8 361 Chloroplast and Mitochondria Gene Families AT3G48850 70.3 1.8e-143 505.8
HCH9g0028 . 58 390 Chloroplast and Mitochondria Gene Families AT3G48850 70.2 5.9e-142 500.7
HCH7g0391 . 26 314 Chloroplast and Mitochondria Gene Families AT3G48850 52.2 1.2e-86 317.0
HCH7g0391 . 23 325 Chloroplast and Mitochondria Gene Families AT2G17270 73.7 1.5e-130 462.6
HCH10g1107 . 65 368 Chloroplast and Mitochondria Gene Families AT2G17270 51.0 3.3e-85 312.0
HCH9g0028 . 94 385 Chloroplast and Mitochondria Gene Families AT2G17270 52.4 5.6e-85 311.2
HCH13g0668 . 16 320 Chloroplast and Mitochondria Gene Families AT5G15640 78.5 1.8e-134 475.7
HCH7g1002 . 17 320 Chloroplast and Mitochondria Gene Families AT5G15640 51.3 3.9e-81 298.5
HCH12g0478 . 12 341 Chloroplast and Mitochondria Gene Families AT5G26200 66.1 4.9e-122 434.5
HCH4g1500 . 1 343 Chloroplast and Mitochondria Gene Families AT5G26200 58.9 1.2e-107 386.7
HCH4g1500 . 1 347 Chloroplast and Mitochondria Gene Families AT1G72820 76.3 1.9e-150 528.9
HCH12g0478 . 1 342 Chloroplast and Mitochondria Gene Families AT1G72820 68.7 8.8e-127 450.3
HCH11g1252 . 93 296 Chloroplast and Mitochondria Gene Families AT5G52570 57.4 3.5e-55 211.8
HCH5g0538 . 81 286 Chloroplast and Mitochondria Gene Families AT5G52570 52.9 1.4e-48 189.9
HCH11g1252 . 1 215 Chloroplast and Mitochondria Gene Families AT4G25700 64.9 1.7e-70 262.7
HCH5g0538 . 75 204 Chloroplast and Mitochondria Gene Families AT4G25700 76.9 7.5e-55 210.7
HCH6g0709 . 73 358 Chloroplast and Mitochondria Gene Families AT5G54290 81.3 1.7e-122 436.0
HCH8g0990 . 38 543 Chloroplast and Mitochondria Gene Families AT2G18710 84.1 1.4e-240 828.9
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0000158 13 5 7 13 5 6 0 6 5 5 5 5 10 6 7 9 5 6 7 6 6 18 5 5 6 7 8 8 5 2 201