Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
HCH2g1168 ATGAGCGTAATCGATATTATCTTCCGAGTTGATGTTATTTGCAAGAGATATGACAAATACGACGTTGAAAAACAGCGTGAGCTCAATGCCTATGGTGATGATGCCTTTGCTCGCCTATTTGCCGCTGTCGAATTCGAAATTGATGCCACTCTTCAGAAATCTGAACTGGCTTCAACTGAGAAGAATAGAGCTTCTGCGGTTGCGATGAACGCTGAGATACGGAGGAAAAAGGCTCGGTTGATGGACGAAGTGCCGAAGCTACGTAAATTGGCTCAGAAGAAGATCAAAGGGGTTGCGAAAGAAGAGCTCGCGGTCAGAGACGATCTAGTTCTCGGGCTGTCAGAGAGGATTCAAGCAATACCAGATGGTAGTACATCAGCTGCCAAACAATCTGGAGGAGGGGCATCCTCATCATCACATCAAAATATCAAATTTGATTCATCAGATGGAAATTTTGAGAGTGATTTTTTCCAGCAAAGTGAAGAATCGAGTCAATTTCGACAGGAATATGAAATGCGGAAAATGAAACAGGATCAAGGTCTTGATTTCATATCAGAAGGATTGGATACTCTGAAAAATCTGGCACATGATATGAATGAGGAAATGGACAGGCAAGTTCCATTAATCGACGAGATCGATACGAAGGTAGACAATGTGACTTCTGATCTAAAAAACACTAATGTTAGACTTAAGGAAACACTTTTCCAGGTGAGATCCAGCCGAAACTTCTGCATCGATATCATTCTTCTGTGTGTAATTCTTGGAATTGTTTCTTACTTGTACAATATATTGAAGTGA 798 41.23 MSVIDIIFRVDVICKRYDKYDVEKQRELNAYGDDAFARLFAAVEFEIDATLQKSELASTEKNRASAVAMNAEIRRKKARLMDEVPKLRKLAQKKIKGVAKEELAVRDDLVLGLSERIQAIPDGSTSAAKQSGGGASSSSHQNIKFDSSDGNFESDFFQQSEESSQFRQEYEMRKMKQDQGLDFISEGLDTLKNLAHDMNEEMDRQVPLIDEIDTKVDNVTSDLKNTNVRLKETLFQVRSSRNFCIDIILLCVILGIVSYLYNILK 265
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
2 54247173 54248763 + evm.model.ptg000010l.336 HCH2g1168 540393

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
HCH2g1168 265 SMART tSNARE_6 166 233 IPR000727 -
HCH2g1168 265 PANTHER SYNTAXIN 51 251 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0006886(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
HCH2g1168 265 FunFam Putative syntaxin-71-like 171 232 - -
HCH2g1168 265 CDD SNARE_Qc 176 232 - -
HCH2g1168 265 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 171 233 IPR000727 -
HCH2g1168 265 MobiDBLite consensus disorder prediction 122 145 - -
HCH2g1168 265 Pfam SNARE domain 208 258 IPR000727 -
HCH2g1168 265 SUPERFAMILY SNARE fusion complex 164 231 - -
HCH2g1168 265 Gene3D - 171 232 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
HCH2g1168 K08506 - - csv:101211289 418.313
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
HCH2g1168 HCH-Chr2:54247173 HCH7g0806 HCH-Chr7:15192340 4.40E-22 dispersed
HCH11g0272 HCH-Chr11:2469918 HCH2g1168 HCH-Chr2:54247173 1.50E-99 wgd
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
HCH4g0394 . 8 339 SNARE and Associated Proteins AT3G24350 66.5 1.1e-103 373.6
HCH9g0881 . 1 308 SNARE and Associated Proteins AT1G08560 66.6 7.6e-106 380.6
HCH14g0577 . 1 304 SNARE and Associated Proteins AT2G18260 54.9 3.3e-85 312.0
HCH11g0485 . 19 279 SNARE and Associated Proteins AT3G11820 81.6 5.7e-117 417.5
HCH9g1199 . 27 282 SNARE and Associated Proteins AT3G11820 73.0 1.0e-102 370.2
HCH3g0609 . 21 280 SNARE and Associated Proteins AT3G11820 65.8 1.8e-94 342.8
HCH9g1403 . 31 285 SNARE and Associated Proteins AT3G11820 51.0 1.9e-67 253.1
HCH11g0485 . 1 279 SNARE and Associated Proteins AT3G52400 64.3 4.8e-93 338.2
HCH9g1199 . 1 282 SNARE and Associated Proteins AT3G52400 60.5 1.9e-86 316.2
HCH3g0609 . 1 280 SNARE and Associated Proteins AT3G52400 59.0 9.0e-84 307.4
HCH3g0609 . 1 295 SNARE and Associated Proteins AT4G03330 69.1 1.4e-107 386.3
HCH11g0485 . 1 279 SNARE and Associated Proteins AT4G03330 59.3 3.9e-86 315.1
HCH9g1199 . 1 288 SNARE and Associated Proteins AT4G03330 53.8 9.2e-80 293.9
HCH9g1403 . 1 290 SNARE and Associated Proteins AT4G03330 50.3 1.5e-69 260.0
HCH3g0609 . 1 304 SNARE and Associated Proteins AT1G61290 78.3 3.2e-125 444.9
HCH11g0485 . 1 279 SNARE and Associated Proteins AT1G61290 63.5 2.1e-92 335.9
HCH9g1199 . 1 298 SNARE and Associated Proteins AT1G61290 57.5 1.1e-85 313.5
HCH3g0609 . 1 304 SNARE and Associated Proteins AT1G11250 76.3 6.2e-121 430.6
HCH11g0485 . 1 279 SNARE and Associated Proteins AT1G11250 63.1 6.4e-94 340.9
HCH9g1199 . 1 288 SNARE and Associated Proteins AT1G11250 56.4 3.2e-85 312.0
HCH9g1403 . 1 308 SNARE and Associated Proteins AT3G03800 72.4 3.5e-119 424.9
HCH2g0746 . 1 304 SNARE and Associated Proteins AT3G03800 55.3 9.2e-80 293.9
HCH9g1403 . 1 203 SNARE and Associated Proteins AT5G08080 77.8 4.7e-81 297.7
HCH2g0746 . 1 203 SNARE and Associated Proteins AT5G08080 58.1 7.0e-53 204.1
HCH6g1130 . 1 256 SNARE and Associated Proteins AT5G16830 58.4 5.3e-74 274.6
HCH6g1130 . 1 256 SNARE and Associated Proteins AT5G46860 65.6 2.8e-80 295.4
HCH6g1130 . 1 256 SNARE and Associated Proteins AT4G17730 59.1 2.7e-72 268.9
HCH6g1130 . 65 256 SNARE and Associated Proteins AT1G32270 61.5 1.1e-52 204.1
HCH1g0387 . 1 340 SNARE and Associated Proteins AT5G05760 64.8 6.5e-111 397.5
HCH4g0394 . 8 339 SNARE and Associated Proteins AT3G24350 66.5 1.1e-103 373.6
HCH10g0899 . 1 325 SNARE and Associated Proteins AT5G26980 77.8 2.1e-130 462.2
HCH4g1049 . 1 320 SNARE and Associated Proteins AT5G26980 66.5 3.0e-105 378.6
HCH4g1049 . 1 320 SNARE and Associated Proteins AT4G02195 67.7 9.0e-110 393.7
HCH10g0899 . 1 327 SNARE and Associated Proteins AT4G02195 65.3 6.1e-106 380.9
HCH10g0899 . 1 326 SNARE and Associated Proteins AT3G05710 76.3 3.3e-131 464.9
HCH4g1049 . 1 320 SNARE and Associated Proteins AT3G05710 64.3 3.8e-103 371.7
HCH12g1219 . 1 233 SNARE and Associated Proteins AT1G16240 72.1 1.1e-88 323.2
HCH6g0844 . 41 270 SNARE and Associated Proteins AT1G16240 64.3 4.5e-79 291.2
HCH12g1219 . 1 233 SNARE and Associated Proteins AT1G79590 71.2 3.9e-87 318.2
HCH6g0844 . 40 270 SNARE and Associated Proteins AT1G79590 64.5 4.7e-80 294.7
HCH12g1197 . 54 244 SNARE and Associated Proteins AT1G28490 69.3 1.2e-64 243.0
HCH11g0272 . 1 264 SNARE and Associated Proteins AT3G09740 78.9 5.2e-111 397.5
HCH2g1168 . 1 265 SNARE and Associated Proteins AT3G09740 68.2 1.4e-95 346.3
HCH2g1168 . 1 265 SNARE and Associated Proteins AT3G45280 68.5 1.2e-94 343.2
HCH11g0272 . 1 264 SNARE and Associated Proteins AT3G45280 64.4 1.8e-87 319.3
HCH11g0272 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 3.9e-95 344.7
HCH2g1168 . 1 262 SNARE and Associated Proteins AT3G61450 59.5 1.8e-84 309.3
HCH13g0530 . 65 309 SNARE and Associated Proteins AT1G51740 74.0 1.5e-93 339.3
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002038 1 2 1 1 1 2 3 2 2 2 2 2 3 3 2 3 2 2 3 2 3 2 2 2 2 2 3 2 2 2 63