Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Hepe02g2765 ATGAACGATCTTCTTTCGGATTCCTTTGAGATCCCTCGGGGTCAAACTTCTAGAGGAGGAGACATTGAGCTAGGAAATGCTCCTACTAATGCAGGGGATCTGGGCTTGGAGGATTTCTTTAAAAAGGTCCAAGATATTGAAAAACAGAATGAGAAGCTGGATAAGCTACTAAAAAAACTCCAGGATTCACACGAGGAGTCCAAAGCTGTGACTAAAGCTCCTGCAATGAAAGCAATCAAGCAGCGGATGGAAAAGGATGTCGATGAAGTTGGAAAAGTTGCACGTTTTCTGAAGGCCAAAGTCGAAGAACTCGACAAAGAGAATCTGGCAAATAGGCAGAGGCCTGGGTGTGGAAAAGGATCAGGTGTAGATAGATCAAGAACAGCAACTACTCTTGCCTTGAAAAAGAAGTTGAAAGACAAGATGACTGAATTCCAGGTTTTACGTGAAAAAATCCAACAAGAGTATCGGGAGGTTGTTGAGAGACGGGTTTTCACAGTCACGGGCGCTAGGGCTGATGAAGAGACCATCGAGAAATTAATTGAAACTGGGGACAGTGAACAAATTTTTCAGAAGGCAATTCAAGAACAAGGGCGAGGACAGGTAATGGACACTCTAGCTGAAATTCAAGAGCGTCACAGTGCAGTTAGAGAACTAGAGAGGAAGTTACTCGAGCTACAGCAGGTATTTCTCGACATGGCAGTATTGGTAGATGCACAAGGGGATATGCTTGACAATATCGAATCACATGTTACAAGTGCAGTAGATCATGTGCAACAAGGGAATACTGCTCTTCAAAAGGCAAAGAAGCTGCAACGGAATTCTAGGAAATGGATGTGCATTGCCATCATAATCCTTCTACTCGTTGTTGTGGTCGTAGTTGTGGGAGTTCTTAAGCCATGGAATAATGGTAAGGGTGCCTAA 924 43.61 MNDLLSDSFEIPRGQTSRGGDIELGNAPTNAGDLGLEDFFKKVQDIEKQNEKLDKLLKKLQDSHEESKAVTKAPAMKAIKQRMEKDVDEVGKVARFLKAKVEELDKENLANRQRPGCGKGSGVDRSRTATTLALKKKLKDKMTEFQVLREKIQQEYREVVERRVFTVTGARADEETIEKLIETGDSEQIFQKAIQEQGRGQVMDTLAEIQERHSAVRELERKLLELQQVFLDMAVLVDAQGDMLDNIESHVTSAVDHVQQGNTALQKAKKLQRNSRKWMCIAIIILLLVVVVVVVGVLKPWNNGKGA 307
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
2 76232596 76250371 - Hsped.02g27650.1 Hepe02g2765 564266

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Hepe02g2765 307 Gene3D - 196 299 - -
Hepe02g2765 307 PANTHER SYNTAXIN 38 286 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0005886(PANTHER)|GO:0006886(PANTHER)|GO:0006887(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Hepe02g2765 307 Coils Coil 36 70 - -
Hepe02g2765 307 SMART tSNARE_6 201 268 IPR000727 -
Hepe02g2765 307 FunFam Syntaxin 132 199 299 - -
Hepe02g2765 307 Coils Coil 135 155 - -
Hepe02g2765 307 Coils Coil 87 107 - -
Hepe02g2765 307 CDD SNARE_syntaxin1-like 205 267 - -
Hepe02g2765 307 Coils Coil 209 229 - -
Hepe02g2765 307 ProSitePatterns Syntaxin / epimorphin family signature. 212 251 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Hepe02g2765 307 SMART SynN_4 31 157 IPR006011 GO:0016020(InterPro)
Hepe02g2765 307 FunFam Syntaxin 132 31 160 - -
Hepe02g2765 307 Pfam Syntaxin 38 241 IPR006011 GO:0016020(InterPro)
Hepe02g2765 307 MobiDBLite consensus disorder prediction 1 28 - -
Hepe02g2765 307 Pfam SNARE domain 242 294 IPR000727 -
Hepe02g2765 307 Gene3D - 33 160 - -
Hepe02g2765 307 SUPERFAMILY t-snare proteins 34 261 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Hepe02g2765 307 CDD SynN 36 193 IPR006011 GO:0016020(InterPro)
Hepe02g2765 307 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 206 268 IPR000727 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Hepe02g2765 K08486 - - csv:101203075 480.715
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Hepe02g2765 Hepe-Chr2:76232596 Hepe08g0474 Hepe-Chr8:4173033 2.88e-100 dispersed
Hepe02g2765 Hepe-Chr2:76232596 Hepe04g1076 Hepe-Chr4:65401673 3.31e-78 transposed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Hepe10g0299 . 1 337 SNARE and Associated Proteins AT3G24350 62.8 1.6e-100 363.2
Hepe04g0635 . 1 309 SNARE and Associated Proteins AT1G08560 68.4 9.0e-100 360.5
Hepe04g1523 . 1 304 SNARE and Associated Proteins AT2G18260 54.2 2.3e-84 309.3
Hepe05g0449 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 1.2e-115 413.3
Hepe04g1076 . 26 281 SNARE and Associated Proteins AT3G11820 73.0 1.5e-102 369.8
Hepe07g1958 . 21 281 SNARE and Associated Proteins AT3G11820 64.8 2.8e-93 339.0
Hepe02g2765 . 24 284 SNARE and Associated Proteins AT3G11820 50.6 2.4e-68 256.1
Hepe05g0449 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 9.9e-92 334.0
Hepe04g1076 . 1 281 SNARE and Associated Proteins AT3G52400 60.1 4.8e-86 315.1
Hepe07g1958 . 1 281 SNARE and Associated Proteins AT3G52400 55.3 3.0e-80 295.8
Hepe07g1958 . 1 299 SNARE and Associated Proteins AT4G03330 66.6 4.8e-106 381.3
Hepe05g0449 . 1 279 SNARE and Associated Proteins AT4G03330 57.9 2.9e-82 302.4
Hepe04g1076 . 1 299 SNARE and Associated Proteins AT4G03330 51.3 2.1e-77 286.2
Hepe02g2765 . 1 284 SNARE and Associated Proteins AT4G03330 52.8 6.6e-71 264.6
Hepe07g1958 . 1 299 SNARE and Associated Proteins AT1G61290 78.9 1.7e-127 452.6
Hepe05g0449 . 1 279 SNARE and Associated Proteins AT1G61290 62.8 2.8e-90 328.9
Hepe04g1076 . 1 293 SNARE and Associated Proteins AT1G61290 56.3 1.0e-84 310.5
Hepe07g1958 . 1 299 SNARE and Associated Proteins AT1G11250 76.3 9.5e-123 436.8
Hepe05g0449 . 1 279 SNARE and Associated Proteins AT1G11250 62.4 2.3e-92 335.9
Hepe04g1076 . 1 290 SNARE and Associated Proteins AT1G11250 57.9 3.4e-88 322.0
Hepe02g2765 . 1 284 SNARE and Associated Proteins AT1G11250 50.7 5.5e-70 261.5
Hepe02g2765 . 1 307 SNARE and Associated Proteins AT3G03800 74.9 4.5e-120 427.9
Hepe08g0474 . 1 270 SNARE and Associated Proteins AT3G03800 59.3 2.7e-80 295.8
Hepe02g2765 . 1 202 SNARE and Associated Proteins AT5G08080 80.2 1.2e-82 303.1
Hepe08g0474 . 2 169 SNARE and Associated Proteins AT5G08080 62.5 1.4e-49 193.4
Hepe06g1000 . 1 256 SNARE and Associated Proteins AT5G16830 59.2 3.1e-75 278.9
Hepe06g1000 . 1 256 SNARE and Associated Proteins AT5G46860 65.6 4.0e-80 295.0
Hepe06g1000 . 1 256 SNARE and Associated Proteins AT4G17730 60.5 2.7e-73 272.3
Hepe06g1000 . 65 256 SNARE and Associated Proteins AT1G32270 59.4 8.5e-51 198.0
Hepe01g0729 . 1 334 SNARE and Associated Proteins AT5G05760 65.7 6.1e-110 394.4
Hepe10g0299 . 1 337 SNARE and Associated Proteins AT3G24350 62.8 1.6e-100 363.2
Hepe08g2281 . 1 327 SNARE and Associated Proteins AT5G26980 75.2 1.1e-124 443.4
Hepe03g1868 . 90 409 SNARE and Associated Proteins AT5G26980 65.8 2.4e-103 372.5
Hepe08g2281 . 1 329 SNARE and Associated Proteins AT4G02195 63.7 3.1e-103 372.1
Hepe03g1868 . 90 409 SNARE and Associated Proteins AT4G02195 64.9 6.9e-103 370.9
Hepe08g2281 . 1 328 SNARE and Associated Proteins AT3G05710 74.2 1.7e-125 446.0
Hepe03g1868 . 90 409 SNARE and Associated Proteins AT3G05710 63.1 1.6e-99 359.8
Hepe01g1245 . 1 233 SNARE and Associated Proteins AT1G16240 70.0 2.2e-87 318.9
Hepe01g1245 . 1 233 SNARE and Associated Proteins AT1G79590 70.0 5.7e-87 317.8
Hepe01g1268 . 56 246 SNARE and Associated Proteins AT1G28490 70.5 2.3e-64 242.3
Hepe05g0250 . 1 264 SNARE and Associated Proteins AT3G09740 80.5 3.6e-113 404.8
Hepe08g0878 . 1 262 SNARE and Associated Proteins AT3G09740 65.5 6.5e-91 330.9
Hepe05g0250 . 1 264 SNARE and Associated Proteins AT3G45280 65.2 3.6e-89 325.1
Hepe08g0878 . 1 262 SNARE and Associated Proteins AT3G45280 64.9 2.0e-87 319.3
Hepe05g0250 . 1 261 SNARE and Associated Proteins AT3G61450 67.8 9.6e-95 343.6
Hepe08g0878 . 1 262 SNARE and Associated Proteins AT3G61450 58.0 5.1e-80 294.7
Hepe06g0203 . 439 683 SNARE and Associated Proteins AT1G51740 73.2 3.2e-92 335.1
Hepe02g3337 . 65 306 SNARE and Associated Proteins AT1G51740 72.8 3.0e-90 328.6
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0001189 1 6 1 1 1 2 3 2 2 2 2 2 3 2 3 3 2 4 3 2 3 1 2 3 3 2 3 8 3 2 77