Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Hepe03g1870 ATGGCTACCGGTTCTCATGCTCCTACTCCCAGGGGTCTTCTCTGTAATGCTGGAGCTGGTGCTGCTGCTGGAGTTCTTGCTGCTACGTTTGTATGCCCTTTGGATGTTATCAAGACTAGATTTCAGGTTCATGGACTGCCAAAGATTGAAGGGAGTCTTATAGTTGGTAGTCTAAAACAAATTGCTCATAAGGAGGGGTTACGTGGAATGTACAGAGGACTCTCACCTACTGTGCTTGCATTACTTCCTAACTGGGCTGTTTATTTCACAATCTATGGGCAGCTTAAAAGCTTTCTTTGCTCTGATGATAAAAACCATCAGCTTTCTATAGGTGCTAATATGTTGGCTGCTTCTGGTGCTGGGGCTGCTACAACTATTGCAACTAATCCTCTATGGGTAGTTAAGACCAGACTTCAGACGCAGGGAATGAAATCTGGTGTGCTACCGTATAGAAATACAGTGTCTGCCTTGAGGAGAATAGCCTTGGAAGAAGGCATCCGTGGATTGTACAGGTTCTCTCTTTCTTATCATGTTGCCATTCTGATCTATGTATTTTATATGGAGAAAACGATTGCAATGATTATTGGCTCATCTGTAACACTTGATACCGTGTTCTACAGTGGTCTTGTGCCTGCTTTGGCTGGTGTAAGTCACGTCGCGATCCAGTTTCCAACATACGAGAAAATAAAAAGTTATTTGGTTAGAAGAGATAATAGGACGACGGATAAACTCAACGCACGTGATGTAGCGGTTGCCTCGTCTGTCTCCAAGATTTTTGCTTCCACATTGACCTATCCACATGAGGTTGTACGTTCCAGGCTTCAGGAACAAGGGTTTCACTCCGAGAAGCGTTATTCTGGCGTAACCGATTGCGTGAAGAAAGTATTTCAGCAAGATGGTATCCCTGGTTTCTATCGAGGGTGCGCAACCAACCTTCTTAGGACGACGCCTGCAGCTGTCATCACATTTACCAGCTTTGAAATGATTCACCGTTTTCTTGTCAACTTATTTCCTCCCGATCCGCATCCACACACATTATGA 1041 44.38 MATGSHAPTPRGLLCNAGAGAAAGVLAATFVCPLDVIKTRFQVHGLPKIEGSLIVGSLKQIAHKEGLRGMYRGLSPTVLALLPNWAVYFTIYGQLKSFLCSDDKNHQLSIGANMLAASGAGAATTIATNPLWVVKTRLQTQGMKSGVLPYRNTVSALRRIALEEGIRGLYRFSLSYHVAILIYVFYMEKTIAMIIGSSVTLDTVFYSGLVPALAGVSHVAIQFPTYEKIKSYLVRRDNRTTDKLNARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGFHSEKRYSGVTDCVKKVFQQDGIPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVNLFPPDPHPHTL 346
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
3 75697492 75703574 + Hsped.03g18700.1 Hepe03g1870 566868

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Hepe03g1870 346 Gene3D Mitochondrial carrier domain 203 335 IPR023395 -
Hepe03g1870 346 PRINTS Mitochondrial carrier protein signature 253 275 IPR002067 GO:0055085(InterPro)
Hepe03g1870 346 PRINTS Mitochondrial carrier protein signature 123 141 IPR002067 GO:0055085(InterPro)
Hepe03g1870 346 PRINTS Mitochondrial carrier protein signature 73 93 IPR002067 GO:0055085(InterPro)
Hepe03g1870 346 PRINTS Mitochondrial carrier protein signature 16 29 IPR002067 GO:0055085(InterPro)
Hepe03g1870 346 PRINTS Mitochondrial carrier protein signature 29 43 IPR002067 GO:0055085(InterPro)
Hepe03g1870 346 ProSiteProfiles Solute carrier (Solcar) repeat profile. 11 98 IPR018108 -
Hepe03g1870 346 Gene3D Mitochondrial carrier domain 2 194 IPR023395 -
Hepe03g1870 346 ProSiteProfiles Solute carrier (Solcar) repeat profile. 108 197 IPR018108 -
Hepe03g1870 346 Pfam Mitochondrial carrier protein 15 101 IPR018108 -
Hepe03g1870 346 Pfam Mitochondrial carrier protein 249 335 IPR018108 -
Hepe03g1870 346 Pfam Mitochondrial carrier protein 107 171 IPR018108 -
Hepe03g1870 346 FunFam Nicotinamide adenine dinucleotide transporter 1, chloroplastic 2 104 - -
Hepe03g1870 346 SUPERFAMILY Mitochondrial carrier 13 174 IPR023395 -
Hepe03g1870 346 SUPERFAMILY Mitochondrial carrier 205 328 IPR023395 -
Hepe03g1870 346 ProSiteProfiles Solute carrier (Solcar) repeat profile. 244 332 IPR018108 -
Hepe03g1870 346 PANTHER MITOCHONDRIAL NICOTINAMIDE ADENINE DINUCLEOTIDE TRANSPORTER 1-RELATED-RELATED 11 172 IPR044712 GO:0006862(InterPro)|GO:0022857(PANTHER)|GO:0035352(PANTHER)|GO:0051724(PANTHER)|GO:0055085(InterPro)|GO:0055085(PANTHER)
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Hepe03g1870 K15115 - - csv:101204681 533.487
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Hepe02g2690 Hepe-Chr2:74687938 Hepe03g1870 Hepe-Chr3:75697492 1.15e-132 dispersed
Hepe03g1870 Hepe-Chr3:75697492 Hepe04g1556 Hepe-Chr4:71094407 3.65e-42 dispersed
Hepe07g2442 Hepe-Chr7:68767739 Hepe03g1870 Hepe-Chr3:75697492 1.23e-06 dispersed
Hepe03g1870 Hepe-Chr3:75697492 Hepe01g2032 Hepe-Chr1:85030691 5.60e-16 transposed
       

Deco-Alignment


Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi7g348 . . . . . . Bma13g00073 . Cmo08g00433 Cmo17g01033 . . . . Sed07g0813 Cpe17g00770 . Bhi09g00933 Tan06g0765 Cmetu09g1187 . Hepe03g1870 . . Cla09g00508 Cam09g0550 Cec09g0540 Cco09g0536 Clacu09g0550 . Cre09g0528 Cone17ag0445 Cone20ag0967 . . Lsi02g02438 Csa07g01874 . Cme01g02233 . . . . . . . . . . . Cma08g00444 . . Car17g01010 . Cpe12g00913 . . . . . . . . . . . . . . . . Chy01g01724 .
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Hepe10g1213 . 1 448 Chloroplast and Mitochondria Gene Families AT2G28800 61.4 1.1e-140 496.9
Hepe10g0061 . 73 414 Chloroplast and Mitochondria Gene Families AT2G28800 56.9 7.3e-100 361.3
Hepe02g0760 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 80.8 4.7e-118 421.0
Hepe07g1785 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 9.8e-120 426.8
Hepe03g0532 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.3 2.4e-118 422.2
Hepe03g0533 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.3 2.4e-118 422.2
Hepe07g1783 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 74.8 7.0e-118 420.6
Hepe02g1178 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.1 1.2e-117 419.9
Hepe01g1350 . 3 264 Chloroplast and Mitochondria Gene Families AT3G27690 68.4 8.1e-98 354.0
Hepe07g1095 . 5 262 Chloroplast and Mitochondria Gene Families AT3G27690 67.4 3.1e-97 352.1
Hepe06g0214 . 72 275 Chloroplast and Mitochondria Gene Families AT3G27690 53.1 2.1e-53 206.5
Hepe10g1514 . 3 267 Chloroplast and Mitochondria Gene Families AT3G61470 80.9 5.0e-128 454.1
Hepe09g0945 . 61 266 Chloroplast and Mitochondria Gene Families AT3G61470 66.5 1.4e-85 313.2
Hepe09g0112 . 22 249 Chloroplast and Mitochondria Gene Families AT3G61470 51.7 5.0e-64 241.5
Hepe02g2965 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 82.1 1.2e-90 329.7
Hepe04g0768 . 2 287 Chloroplast and Mitochondria Gene Families AT3G08940 81.9 2.7e-135 478.4
Hepe01g2379 . 54 316 Chloroplast and Mitochondria Gene Families AT1G76570 81.7 9.7e-129 456.8
Hepe09g1201 . 1 271 Chloroplast and Mitochondria Gene Families AT1G61520 86.1 9.9e-135 476.5
Hepe07g1785 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 77.8 6.7e-120 427.2
Hepe07g1783 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 77.4 1.9e-119 425.6
Hepe03g0532 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 77.4 7.4e-119 423.7
Hepe03g0533 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 77.4 7.4e-119 423.7
Hepe02g1178 . 27 265 Chloroplast and Mitochondria Gene Families AT2G05070 83.7 8.2e-118 420.2
Hepe07g1095 . 8 262 Chloroplast and Mitochondria Gene Families AT2G05070 68.0 7.2e-98 354.0
Hepe01g1350 . 11 264 Chloroplast and Mitochondria Gene Families AT2G05070 68.4 4.7e-97 351.3
Hepe06g0214 . 72 275 Chloroplast and Mitochondria Gene Families AT2G05070 53.6 1.4e-53 206.8
Hepe07g1785 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 2.0e-102 369.4
Hepe07g1783 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.6 1.7e-101 366.3
Hepe03g0532 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.0 3.7e-101 365.2
Hepe03g0533 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.0 3.7e-101 365.2
Hepe02g1178 . 8 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.2 1.6e-99 359.8
Hepe07g1095 . 8 234 Chloroplast and Mitochondria Gene Families AT2G05100 67.6 1.3e-82 303.5
Hepe01g1350 . 11 236 Chloroplast and Mitochondria Gene Families AT2G05100 67.7 2.5e-81 299.3
Hepe06g0214 . 72 259 Chloroplast and Mitochondria Gene Families AT2G05100 51.8 1.4e-44 177.2
Hepe04g0768 . 1 169 Chloroplast and Mitochondria Gene Families AT2G40100 74.6 8.4e-69 256.9
Hepe03g0532 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 89.5 6.1e-137 483.8
Hepe03g0533 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 89.5 6.1e-137 483.8
Hepe07g1785 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.0 9.7e-135 476.5
Hepe07g1783 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 86.9 1.7e-134 475.7
Hepe02g1178 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29930 84.9 1.7e-126 449.1
Hepe01g1350 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29930 75.5 1.7e-94 342.8
Hepe07g1095 . 32 262 Chloroplast and Mitochondria Gene Families AT1G29930 69.8 2.9e-94 342.0
Hepe03g0534 . 1 103 Chloroplast and Mitochondria Gene Families AT1G29930 83.7 4.3e-42 168.7
Hepe03g0532 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 89.1 2.3e-136 481.9
Hepe03g0533 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 89.1 2.3e-136 481.9
Hepe07g1785 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.6 3.7e-134 474.6
Hepe07g1783 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 86.5 6.3e-134 473.8
Hepe02g1178 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29920 84.9 2.2e-126 448.7
Hepe01g1350 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29920 75.5 1.7e-94 342.8
Hepe07g1095 . 32 262 Chloroplast and Mitochondria Gene Families AT1G29920 69.8 2.9e-94 342.0
Hepe03g0534 . 1 103 Chloroplast and Mitochondria Gene Families AT1G29920 82.7 1.6e-41 166.8
Hepe03g0532 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 89.1 2.3e-136 481.9
Hepe03g0533 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 89.1 2.3e-136 481.9
Hepe07g1785 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.6 3.7e-134 474.6
Hepe07g1783 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 86.5 6.3e-134 473.8
Hepe02g1178 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29910 84.9 2.2e-126 448.7
Hepe01g1350 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29910 75.5 1.7e-94 342.8
Hepe07g1095 . 32 262 Chloroplast and Mitochondria Gene Families AT1G29910 69.8 2.9e-94 342.0
Hepe03g0534 . 1 103 Chloroplast and Mitochondria Gene Families AT1G29910 82.7 1.6e-41 166.8
Hepe06g0214 . 11 290 Chloroplast and Mitochondria Gene Families AT4G10340 84.3 2.4e-136 481.9
Hepe02g1178 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 53.6 6.5e-57 218.0
Hepe03g0532 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 51.6 6.5e-57 218.0
Hepe03g0533 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 51.6 6.5e-57 218.0
Hepe07g1785 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 6.5e-57 218.0
Hepe07g1783 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 51.1 8.5e-57 217.6
Hepe07g1095 . 44 250 Chloroplast and Mitochondria Gene Families AT4G10340 53.6 1.1e-51 200.7
Hepe01g1350 . 42 252 Chloroplast and Mitochondria Gene Families AT4G10340 51.4 3.1e-51 199.1
Hepe03g0532 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 3.7e-134 474.6
Hepe03g0533 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 3.7e-134 474.6
Hepe07g1785 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 86.9 5.8e-132 467.2
Hepe07g1783 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 85.8 9.9e-132 466.5
Hepe02g1178 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34420 84.9 4.8e-126 447.6
Hepe01g1350 . 46 264 Chloroplast and Mitochondria Gene Families AT2G34420 75.9 2.2e-94 342.4
Hepe07g1095 . 32 262 Chloroplast and Mitochondria Gene Families AT2G34420 70.2 2.8e-94 342.0
Hepe03g0534 . 1 103 Chloroplast and Mitochondria Gene Families AT2G34420 79.8 4.4e-39 158.7
Hepe03g0532 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 1.8e-136 482.3
Hepe03g0533 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 1.8e-136 482.3
Hepe07g1785 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.0 6.7e-136 480.3
Hepe07g1783 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 86.1 1.6e-134 475.7
Hepe02g1178 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34430 85.2 6.7e-128 453.8
Hepe01g1350 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34430 71.4 2.2e-94 342.4
Hepe07g1095 . 32 262 Chloroplast and Mitochondria Gene Families AT2G34430 71.0 2.8e-94 342.0
Hepe06g0214 . 72 275 Chloroplast and Mitochondria Gene Families AT2G34430 51.0 2.7e-52 202.6
Hepe03g0534 . 1 103 Chloroplast and Mitochondria Gene Families AT2G34430 79.6 2.1e-41 166.4
Hepe04g0768 . 4 287 Chloroplast and Mitochondria Gene Families AT5G01530 83.2 2.7e-138 488.4
Hepe07g0576 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.1 6.1e-142 500.4
Hepe07g0576 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 84.5 8.8e-148 520.0
Hepe08g0701 . 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 73.8 2.7e-142 501.9
Hepe04g0728 . 10 307 Chloroplast and Mitochondria Gene Families AT2G30160 66.0 4.6e-110 394.8
Hepe08g0701 . 5 327 Chloroplast and Mitochondria Gene Families AT1G07030 75.2 1.0e-141 500.0
Hepe04g0728 . 6 307 Chloroplast and Mitochondria Gene Families AT1G07030 69.2 2.9e-117 418.7
Hepe03g1870 . 1 340 Chloroplast and Mitochondria Gene Families AT2G47490 69.6 1.8e-132 469.2
Hepe02g2690 . 1 317 Chloroplast and Mitochondria Gene Families AT2G47490 61.9 8.2e-109 390.6
Hepe02g2690 . 9 357 Chloroplast and Mitochondria Gene Families AT1G25380 63.4 2.4e-120 429.1
Hepe03g1870 . 11 332 Chloroplast and Mitochondria Gene Families AT1G25380 57.8 7.3e-101 364.4
Hepe07g1961 . 6 584 Chloroplast and Mitochondria Gene Families AT4G21490 74.5 2.3e-258 888.3
Hepe08g0511 . 5 584 Chloroplast and Mitochondria Gene Families AT4G21490 69.2 2.8e-240 828.2
Hepe02g0166 . 4 574 Chloroplast and Mitochondria Gene Families AT4G21490 64.9 6.4e-224 773.9
Hepe09g1483 . 10 179 Chloroplast and Mitochondria Gene Families AT1G17530 59.3 1.3e-50 196.4
Hepe09g1483 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 58.4 6.1e-51 197.6
Hepe09g1483 . 5 183 Chloroplast and Mitochondria Gene Families AT1G72750 58.8 2.9e-53 205.3
Hepe10g1863 . 9 243 Chloroplast and Mitochondria Gene Families AT1G26100 60.0 7.1e-73 270.8
Hepe02g3250 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 68.3 7.7e-88 320.5
Hepe06g1255 . 23 233 Chloroplast and Mitochondria Gene Families AT4G25570 66.8 8.4e-81 297.4
Hepe02g2597 . 5 222 Chloroplast and Mitochondria Gene Families AT1G14730 51.4 3.7e-63 238.4
Hepe02g2492 . 6 366 Chloroplast and Mitochondria Gene Families AT5G14040 81.2 1.4e-171 599.4
Hepe02g1660 . 11 371 Chloroplast and Mitochondria Gene Families AT5G14040 75.8 3.0e-158 555.1
Hepe02g0359 . 11 303 Chloroplast and Mitochondria Gene Families AT5G14040 52.2 3.1e-86 315.8
Hepe02g1660 . 8 371 Chloroplast and Mitochondria Gene Families AT3G48850 69.8 3.1e-144 508.4
Hepe02g2492 . 8 364 Chloroplast and Mitochondria Gene Families AT3G48850 69.6 2.9e-142 501.9
Hepe02g0359 . 11 303 Chloroplast and Mitochondria Gene Families AT3G48850 51.5 1.6e-87 320.1
Hepe02g0359 . 14 308 Chloroplast and Mitochondria Gene Families AT2G17270 75.9 3.1e-132 468.4
Hepe02g1660 . 63 370 Chloroplast and Mitochondria Gene Families AT2G17270 50.6 1.5e-86 316.6
Hepe02g2492 . 64 361 Chloroplast and Mitochondria Gene Families AT2G17270 51.7 5.6e-86 314.7
Hepe02g3214 . 16 319 Chloroplast and Mitochondria Gene Families AT5G15640 75.2 1.1e-129 459.9
Hepe05g1353 . 17 319 Chloroplast and Mitochondria Gene Families AT5G15640 50.5 8.1e-80 294.3
Hepe01g1906 . 12 344 Chloroplast and Mitochondria Gene Families AT5G26200 67.3 1.1e-122 436.8
Hepe03g1443 . 1 344 Chloroplast and Mitochondria Gene Families AT5G26200 57.4 2.1e-105 379.4
Hepe03g1443 . 1 348 Chloroplast and Mitochondria Gene Families AT1G72820 76.4 1.0e-147 520.0
Hepe01g1906 . 1 347 Chloroplast and Mitochondria Gene Families AT1G72820 69.1 6.7e-128 454.1
Hepe06g1518 . 78 283 Chloroplast and Mitochondria Gene Families AT5G52570 53.9 2.0e-51 199.5
Hepe07g0127 . 1 215 Chloroplast and Mitochondria Gene Families AT4G25700 65.3 6.3e-71 264.2
Hepe06g1518 . 39 200 Chloroplast and Mitochondria Gene Families AT4G25700 64.3 2.1e-58 222.6
Hepe02g0164 . 109 302 Chloroplast and Mitochondria Gene Families AT4G03320 51.3 3.2e-59 225.7
Hepe07g1089 . 12 334 Chloroplast and Mitochondria Gene Families AT5G54290 67.0 5.4e-109 391.3
Hepe09g0521 . 33 542 Chloroplast and Mitochondria Gene Families AT2G18710 83.0 7.9e-240 826.6
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002161 2 2 0 1 2 2 3 2 2 2 2 2 2 2 2 3 2 4 2 2 2 2 2 2 2 2 2 4 2 2 63