Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Hepe04g0635 ATGAATGACTTGATGACCAAATCCTTCACCAGCTATGTTGATCTGAAGAAAGCCGCCATGAAAGATATCGATCTCGAAGCCGGTTTAGAAATGGCATCGGCCGCTGCCAGCGACAATGGCGATATGGGACTCTTCCTGGAAGAGGCCGAGAGGGTCAAAATGGAGATGGGTTCAATTAGAGAGATCTTAGGGAAGCTTCAGCAGGCAAATGAGGAGACTAAATCTGCTCACAAACCCGAAACTCTCAAATCGCTTCGCAATACGATCAATGCCGACATCGTCACCGTCTTGAAGAAGGCGCGGTCGATCCGATCCCAGCTCGAGGAAATGGACCGTACCAATGCTGCCAAGAAGAGGCTCTCCGGCAGCAAAGAGGGCACTGCCATTTATAGGACTCGAATTGCGGTGACGAACGGGCTGCGAAAGAAGCTAAAGGAGCTGATGATGGAGTTTCAGGGGCTAAGGCAGAGGATGATGACGGAGTACAAGGAGACGGTGGGGAGGCGATACTTCACGGTGACGGGGGAGCAGGCGGAGGAGGAGGTGATAGAGAAGATAATATCGAACGGTGGGGAGGAGTATTTGGGGAGGGCGATAGAGGAGCACGGGCGGGGGAAGGTGGCGGAGACGGTGGTGGAGATACAAGACCGACACGGGGCGGCGAAGGAGATAGAGAGAAGCTTGCTAGAGTTGCACCAAGTGTTTTTGGACATGGCAGTGATGGTGGAAGCACAAGGGGAGAAAATGGATGACATTGAACATCATGTGTTGAATGCTTCACAATATGTTAGAGATGGGACTAAGGATTTGAAGACTGCTAAGGATTTGCAAAGAAGTTCAAGGAAATGTATGATTTTGGGGATTTTGCTTTTGCTTCTTCTTATTTTGGTTGTTGTTATTCCCATTGCTGTTAGTTTTGGGAGTTCTTGA 930 49.68 MNDLMTKSFTSYVDLKKAAMKDIDLEAGLEMASAAASDNGDMGLFLEEAERVKMEMGSIREILGKLQQANEETKSAHKPETLKSLRNTINADIVTVLKKARSIRSQLEEMDRTNAAKKRLSGSKEGTAIYRTRIAVTNGLRKKLKELMMEFQGLRQRMMTEYKETVGRRYFTVTGEQAEEEVIEKIISNGGEEYLGRAIEEHGRGKVAETVVEIQDRHGAAKEIERSLLELHQVFLDMAVMVEAQGEKMDDIEHHVLNASQYVRDGTKDLKTAKDLQRSSRKCMILGILLLLLLILVVVIPIAVSFGSS 309
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
4 59513215 59514797 - Hsped.04g06350.1 Hepe04g0635 567773

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Hepe04g0635 309 CDD SNARE_syntaxin1-like 210 272 - -
Hepe04g0635 309 SMART tSNARE_6 206 273 IPR000727 -
Hepe04g0635 309 FunFam Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group 39 169 - -
Hepe04g0635 309 Pfam Syntaxin 45 246 IPR006011 GO:0016020(InterPro)
Hepe04g0635 309 ProSitePatterns Syntaxin / epimorphin family signature. 217 257 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Hepe04g0635 309 Gene3D - 206 307 - -
Hepe04g0635 309 FunFam Syntaxin 132 204 304 - -
Hepe04g0635 309 Pfam SNARE domain 248 299 IPR000727 -
Hepe04g0635 309 Gene3D - 37 166 - -
Hepe04g0635 309 SMART SynN_4 37 163 IPR006011 GO:0016020(InterPro)
Hepe04g0635 309 SUPERFAMILY t-snare proteins 41 266 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Hepe04g0635 309 CDD SynN 42 198 IPR006011 GO:0016020(InterPro)
Hepe04g0635 309 Coils Coil 137 157 - -
Hepe04g0635 309 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 211 273 IPR000727 -
Hepe04g0635 309 PANTHER SYNTAXIN 48 292 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0005886(PANTHER)|GO:0006886(PANTHER)|GO:0006887(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Hepe04g0635 K08486 - - csv:101220775 527.324
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Hepe04g0635 Hepe-Chr4:59513215 Hepe07g1958 Hepe-Chr7:63486193 5.79e-83 dispersed
Hepe04g0635 Hepe-Chr4:59513215 Hepe05g0449 Hepe-Chr5:5903970 2.02e-70 transposed
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi8g156 . . . . . . . . . . Cma03g00248 . Car03g00212 . Sed14g0695 Cpe10g01038 Cpe08g00962 Bhi03g02299 Tan03g0640 Cmetu08g0109 . Hepe04g0635 . . . . . . . . . Cone3ag0557 Cone10ag0552 Cone13ag0475 . Lsi01g01659 Csa04g01137 . Cme04g01796 . . . . . . . . . Cmo03g00262 Cmo07g01220 . . . . . . Bhi11g01551 . . . . . . . . . . . . . . . . Cme08g02007
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Hepe10g0299 . 1 337 SNARE and Associated Proteins AT3G24350 62.8 1.6e-100 363.2
Hepe04g0635 . 1 309 SNARE and Associated Proteins AT1G08560 68.4 9.0e-100 360.5
Hepe04g1523 . 1 304 SNARE and Associated Proteins AT2G18260 54.2 2.3e-84 309.3
Hepe05g0449 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 1.2e-115 413.3
Hepe04g1076 . 26 281 SNARE and Associated Proteins AT3G11820 73.0 1.5e-102 369.8
Hepe07g1958 . 21 281 SNARE and Associated Proteins AT3G11820 64.8 2.8e-93 339.0
Hepe02g2765 . 24 284 SNARE and Associated Proteins AT3G11820 50.6 2.4e-68 256.1
Hepe05g0449 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 9.9e-92 334.0
Hepe04g1076 . 1 281 SNARE and Associated Proteins AT3G52400 60.1 4.8e-86 315.1
Hepe07g1958 . 1 281 SNARE and Associated Proteins AT3G52400 55.3 3.0e-80 295.8
Hepe07g1958 . 1 299 SNARE and Associated Proteins AT4G03330 66.6 4.8e-106 381.3
Hepe05g0449 . 1 279 SNARE and Associated Proteins AT4G03330 57.9 2.9e-82 302.4
Hepe04g1076 . 1 299 SNARE and Associated Proteins AT4G03330 51.3 2.1e-77 286.2
Hepe02g2765 . 1 284 SNARE and Associated Proteins AT4G03330 52.8 6.6e-71 264.6
Hepe07g1958 . 1 299 SNARE and Associated Proteins AT1G61290 78.9 1.7e-127 452.6
Hepe05g0449 . 1 279 SNARE and Associated Proteins AT1G61290 62.8 2.8e-90 328.9
Hepe04g1076 . 1 293 SNARE and Associated Proteins AT1G61290 56.3 1.0e-84 310.5
Hepe07g1958 . 1 299 SNARE and Associated Proteins AT1G11250 76.3 9.5e-123 436.8
Hepe05g0449 . 1 279 SNARE and Associated Proteins AT1G11250 62.4 2.3e-92 335.9
Hepe04g1076 . 1 290 SNARE and Associated Proteins AT1G11250 57.9 3.4e-88 322.0
Hepe02g2765 . 1 284 SNARE and Associated Proteins AT1G11250 50.7 5.5e-70 261.5
Hepe02g2765 . 1 307 SNARE and Associated Proteins AT3G03800 74.9 4.5e-120 427.9
Hepe08g0474 . 1 270 SNARE and Associated Proteins AT3G03800 59.3 2.7e-80 295.8
Hepe02g2765 . 1 202 SNARE and Associated Proteins AT5G08080 80.2 1.2e-82 303.1
Hepe08g0474 . 2 169 SNARE and Associated Proteins AT5G08080 62.5 1.4e-49 193.4
Hepe06g1000 . 1 256 SNARE and Associated Proteins AT5G16830 59.2 3.1e-75 278.9
Hepe06g1000 . 1 256 SNARE and Associated Proteins AT5G46860 65.6 4.0e-80 295.0
Hepe06g1000 . 1 256 SNARE and Associated Proteins AT4G17730 60.5 2.7e-73 272.3
Hepe06g1000 . 65 256 SNARE and Associated Proteins AT1G32270 59.4 8.5e-51 198.0
Hepe01g0729 . 1 334 SNARE and Associated Proteins AT5G05760 65.7 6.1e-110 394.4
Hepe10g0299 . 1 337 SNARE and Associated Proteins AT3G24350 62.8 1.6e-100 363.2
Hepe08g2281 . 1 327 SNARE and Associated Proteins AT5G26980 75.2 1.1e-124 443.4
Hepe03g1868 . 90 409 SNARE and Associated Proteins AT5G26980 65.8 2.4e-103 372.5
Hepe08g2281 . 1 329 SNARE and Associated Proteins AT4G02195 63.7 3.1e-103 372.1
Hepe03g1868 . 90 409 SNARE and Associated Proteins AT4G02195 64.9 6.9e-103 370.9
Hepe08g2281 . 1 328 SNARE and Associated Proteins AT3G05710 74.2 1.7e-125 446.0
Hepe03g1868 . 90 409 SNARE and Associated Proteins AT3G05710 63.1 1.6e-99 359.8
Hepe01g1245 . 1 233 SNARE and Associated Proteins AT1G16240 70.0 2.2e-87 318.9
Hepe01g1245 . 1 233 SNARE and Associated Proteins AT1G79590 70.0 5.7e-87 317.8
Hepe01g1268 . 56 246 SNARE and Associated Proteins AT1G28490 70.5 2.3e-64 242.3
Hepe05g0250 . 1 264 SNARE and Associated Proteins AT3G09740 80.5 3.6e-113 404.8
Hepe08g0878 . 1 262 SNARE and Associated Proteins AT3G09740 65.5 6.5e-91 330.9
Hepe05g0250 . 1 264 SNARE and Associated Proteins AT3G45280 65.2 3.6e-89 325.1
Hepe08g0878 . 1 262 SNARE and Associated Proteins AT3G45280 64.9 2.0e-87 319.3
Hepe05g0250 . 1 261 SNARE and Associated Proteins AT3G61450 67.8 9.6e-95 343.6
Hepe08g0878 . 1 262 SNARE and Associated Proteins AT3G61450 58.0 5.1e-80 294.7
Hepe06g0203 . 439 683 SNARE and Associated Proteins AT1G51740 73.2 3.2e-92 335.1
Hepe02g3337 . 65 306 SNARE and Associated Proteins AT1G51740 72.8 3.0e-90 328.6
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0010730 0 1 0 0 0 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 1 1 1 2 1 1 32