Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Hepe04g1076 ATGAACGATCTGTTTTCCTCCGATTCCTTCCGCAGAGATCAGCCGCACCGCCATGACACCGTCGACCCCACCGCCGCGCCGTCGTCAACGACGATCAATCTCAACAGCTTCTTCGAGGACGTCGAATCCGTGAAGGCGGAATTGACGGAGCTCGAGCGCGTTTATCGAAGCCTCCAGAATTCTCACGAACAGAGCAAGACTCTGCACAACTCCAAGGCGATTAAGGATCTCCGATCTCGAATGGAATCGGATGTGACTTTGGCTCTCAAGAAGGCTAGGTTTATCAAGCTCCGATTGGAGGAACTCGACCGCTCCAACGCCGAGAACCGGAATCTTCCTGGTTGTGGCCATGGCTCCTCCGCCGACCGGTCCAGAAGCTCCGTCGTCAATGGATTGAGGAAGAATCTGTGTGACTCGATGGAGAGTTTCAACAGATTGAGAGAGGAGATCTCGTCGACGTATAAGGAGACGATTCAACGAAGATATTTCACGATTACAGGGGAGAATCCGGATGAGAAGACTGTTGATTTGTTGATCTCTACAGGTGAAAGCGAGACATTCTTGCAAAAGGCAATACAAAAGCAAGGAAGAGGAAGAGTTTTAGAAACAATCCAAGAGATTCAAGAAAGGCATGACGCAGTGAAAGACATAGAAAAAAATCTGAAAGAGTTGCACCAAGTGTTTATGGACATGGCGGTACTGGTCCAAGCGCAGGGGCAACAATTGGACGACATCGAGAGCCAAGTCACTCGAGCCAACTCCGCCGTCAGGCGCGGCACCACCGAGCTACAAACCGCAAGATTCTACCAGAAAAATACTCGAAAATGGATCTGTATCGGTGTCAGCATTTTTATAGTGATCCTCCTCATCATTATCCTTTCCGTCGTTTTGGGAACGAAAAAATAA 906 49.23 MNDLFSSDSFRRDQPHRHDTVDPTAAPSSTTINLNSFFEDVESVKAELTELERVYRSLQNSHEQSKTLHNSKAIKDLRSRMESDVTLALKKARFIKLRLEELDRSNAENRNLPGCGHGSSADRSRSSVVNGLRKNLCDSMESFNRLREEISSTYKETIQRRYFTITGENPDEKTVDLLISTGESETFLQKAIQKQGRGRVLETIQEIQERHDAVKDIEKNLKELHQVFMDMAVLVQAQGQQLDDIESQVTRANSAVRRGTTELQTARFYQKNTRKWICIGVSIFIVILLIIILSVVLGTKK 301
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
4 65401673 65404754 + Hsped.04g10760.1 Hepe04g1076 568214

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Hepe04g1076 301 PANTHER SYNTAXIN 36 287 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0005886(PANTHER)|GO:0006886(PANTHER)|GO:0006887(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Hepe04g1076 301 SUPERFAMILY t-snare proteins 33 259 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Hepe04g1076 301 SMART tSNARE_6 199 266 IPR000727 -
Hepe04g1076 301 Gene3D - 199 298 - -
Hepe04g1076 301 Gene3D - 32 164 - -
Hepe04g1076 301 ProSitePatterns Syntaxin / epimorphin family signature. 210 249 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Hepe04g1076 301 Pfam SNARE domain 241 292 IPR000727 -
Hepe04g1076 301 Coils Coil 34 61 - -
Hepe04g1076 301 CDD SynN 34 191 IPR006011 GO:0016020(InterPro)
Hepe04g1076 301 Pfam Syntaxin 36 239 IPR006011 GO:0016020(InterPro)
Hepe04g1076 301 SMART SynN_4 29 155 IPR006011 GO:0016020(InterPro)
Hepe04g1076 301 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 204 266 IPR000727 -
Hepe04g1076 301 FunFam Syntaxin 132 197 297 - -
Hepe04g1076 301 CDD SNARE_syntaxin1-like 203 265 - -
Hepe04g1076 301 Coils Coil 204 224 - -
Hepe04g1076 301 MobiDBLite consensus disorder prediction 1 28 - -
Hepe04g1076 301 FunFam Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group 31 161 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Hepe04g1076 K08486 - - csv:101213443 482.256
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Hepe04g1076 Hepe-Chr4:65401673 Hepe07g1958 Hepe-Chr7:63486193 7.16e-105 dispersed
Hepe02g2765 Hepe-Chr2:76232596 Hepe04g1076 Hepe-Chr4:65401673 3.31e-78 transposed
Hepe04g1076 Hepe-Chr4:65401673 Hepe05g0449 Hepe-Chr5:5903970 1.04e-136 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi4g990 Blo04g00912 Blo16g00051 . . Bpe15g00424 . . . . . Cma03g00740 . Car03g00676 . Sed14g1127 . Cpe10g00620 Bhi03g01315 Tan03g1990 Cmetu08g1065 . Hepe04g1076 . . . . . . . . . . . . . . . . . . . Bda11g01860 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Csa06g03248 Chy02g00640 .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Hepe10g0299 . 1 337 SNARE and Associated Proteins AT3G24350 62.8 1.6e-100 363.2
Hepe04g0635 . 1 309 SNARE and Associated Proteins AT1G08560 68.4 9.0e-100 360.5
Hepe04g1523 . 1 304 SNARE and Associated Proteins AT2G18260 54.2 2.3e-84 309.3
Hepe05g0449 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 1.2e-115 413.3
Hepe04g1076 . 26 281 SNARE and Associated Proteins AT3G11820 73.0 1.5e-102 369.8
Hepe07g1958 . 21 281 SNARE and Associated Proteins AT3G11820 64.8 2.8e-93 339.0
Hepe02g2765 . 24 284 SNARE and Associated Proteins AT3G11820 50.6 2.4e-68 256.1
Hepe05g0449 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 9.9e-92 334.0
Hepe04g1076 . 1 281 SNARE and Associated Proteins AT3G52400 60.1 4.8e-86 315.1
Hepe07g1958 . 1 281 SNARE and Associated Proteins AT3G52400 55.3 3.0e-80 295.8
Hepe07g1958 . 1 299 SNARE and Associated Proteins AT4G03330 66.6 4.8e-106 381.3
Hepe05g0449 . 1 279 SNARE and Associated Proteins AT4G03330 57.9 2.9e-82 302.4
Hepe04g1076 . 1 299 SNARE and Associated Proteins AT4G03330 51.3 2.1e-77 286.2
Hepe02g2765 . 1 284 SNARE and Associated Proteins AT4G03330 52.8 6.6e-71 264.6
Hepe07g1958 . 1 299 SNARE and Associated Proteins AT1G61290 78.9 1.7e-127 452.6
Hepe05g0449 . 1 279 SNARE and Associated Proteins AT1G61290 62.8 2.8e-90 328.9
Hepe04g1076 . 1 293 SNARE and Associated Proteins AT1G61290 56.3 1.0e-84 310.5
Hepe07g1958 . 1 299 SNARE and Associated Proteins AT1G11250 76.3 9.5e-123 436.8
Hepe05g0449 . 1 279 SNARE and Associated Proteins AT1G11250 62.4 2.3e-92 335.9
Hepe04g1076 . 1 290 SNARE and Associated Proteins AT1G11250 57.9 3.4e-88 322.0
Hepe02g2765 . 1 284 SNARE and Associated Proteins AT1G11250 50.7 5.5e-70 261.5
Hepe02g2765 . 1 307 SNARE and Associated Proteins AT3G03800 74.9 4.5e-120 427.9
Hepe08g0474 . 1 270 SNARE and Associated Proteins AT3G03800 59.3 2.7e-80 295.8
Hepe02g2765 . 1 202 SNARE and Associated Proteins AT5G08080 80.2 1.2e-82 303.1
Hepe08g0474 . 2 169 SNARE and Associated Proteins AT5G08080 62.5 1.4e-49 193.4
Hepe06g1000 . 1 256 SNARE and Associated Proteins AT5G16830 59.2 3.1e-75 278.9
Hepe06g1000 . 1 256 SNARE and Associated Proteins AT5G46860 65.6 4.0e-80 295.0
Hepe06g1000 . 1 256 SNARE and Associated Proteins AT4G17730 60.5 2.7e-73 272.3
Hepe06g1000 . 65 256 SNARE and Associated Proteins AT1G32270 59.4 8.5e-51 198.0
Hepe01g0729 . 1 334 SNARE and Associated Proteins AT5G05760 65.7 6.1e-110 394.4
Hepe10g0299 . 1 337 SNARE and Associated Proteins AT3G24350 62.8 1.6e-100 363.2
Hepe08g2281 . 1 327 SNARE and Associated Proteins AT5G26980 75.2 1.1e-124 443.4
Hepe03g1868 . 90 409 SNARE and Associated Proteins AT5G26980 65.8 2.4e-103 372.5
Hepe08g2281 . 1 329 SNARE and Associated Proteins AT4G02195 63.7 3.1e-103 372.1
Hepe03g1868 . 90 409 SNARE and Associated Proteins AT4G02195 64.9 6.9e-103 370.9
Hepe08g2281 . 1 328 SNARE and Associated Proteins AT3G05710 74.2 1.7e-125 446.0
Hepe03g1868 . 90 409 SNARE and Associated Proteins AT3G05710 63.1 1.6e-99 359.8
Hepe01g1245 . 1 233 SNARE and Associated Proteins AT1G16240 70.0 2.2e-87 318.9
Hepe01g1245 . 1 233 SNARE and Associated Proteins AT1G79590 70.0 5.7e-87 317.8
Hepe01g1268 . 56 246 SNARE and Associated Proteins AT1G28490 70.5 2.3e-64 242.3
Hepe05g0250 . 1 264 SNARE and Associated Proteins AT3G09740 80.5 3.6e-113 404.8
Hepe08g0878 . 1 262 SNARE and Associated Proteins AT3G09740 65.5 6.5e-91 330.9
Hepe05g0250 . 1 264 SNARE and Associated Proteins AT3G45280 65.2 3.6e-89 325.1
Hepe08g0878 . 1 262 SNARE and Associated Proteins AT3G45280 64.9 2.0e-87 319.3
Hepe05g0250 . 1 261 SNARE and Associated Proteins AT3G61450 67.8 9.6e-95 343.6
Hepe08g0878 . 1 262 SNARE and Associated Proteins AT3G61450 58.0 5.1e-80 294.7
Hepe06g0203 . 439 683 SNARE and Associated Proteins AT1G51740 73.2 3.2e-92 335.1
Hepe02g3337 . 65 306 SNARE and Associated Proteins AT1G51740 72.8 3.0e-90 328.6
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002313 5 3 2 3 3 1 2 1 1 2 1 2 2 2 2 2 2 2 3 1 3 2 2 2 3 1 2 3 2 0 62