Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Hepe07g1089 ATGAGTCTCCTTATGAGTCATTCCGCTGGTTTCGGCATCAATTCCATCACAATTCCAACCTCTAAACGTTTACAGATCAAGGCGCGAGGTAAATATTTCGTGCCTATGAAATTGCTAGGGAGACAATCTGCAGCTGAGGATCAAAGTAAAGATATTGAGTTAGTGGAGAATAAAAACATCTGCAATCATTTTCAAGCCATGGCTTTTGTAAATGCCATTTCTGCGACAAGTTTCCTTGCAGTAGATGCAGCAAAGGCCGAGACTGTAAAGGATATGTGGGAAGGAGCTGCTTCTGTTTATACTCTGGCTGATGGTGGCATTGGAGATTGGTTTGGAGGCTTCTTGTTTTCGGCTGGACAACAGGCTAATGTTGCTGTACAGGATCAGTTATCTGCTCTTAGTTTTACTAGTTTGGCAGTAATTTTTGGGGCAGGGTTCGTAACCAGCCTTTCCCCTTGCACACTGAGTGTTTTGCCTTTGACCCTTGGTTACATAGGAGCTTTTGGATCAGGGAAGAGCAGAACAGAGGTTGTTGGAAACTCTGTTGCTTTCTCGTTGGGACTTGCTACGACCCTAGCACTGTTAGGCATAGCAGCTTCTTTTGCTGGAAAGGCATATGGACAGATTGGCCAAGGATTACCTTTGGCTGCTTCAGGCTTAGCTGTTATTATGGGCCTAAACCTACTGGAGGTAGTTGAGTTGCGACTACCCTCATTCTTCGACAATTTCGATCCCCGTTCCGCCGCTGCCAACTTTCCATCAAGTGTGCAAGCATATCTAGCTGGGCTTACGTTTGCTTTGGCTGCATCTCCTTGCAGTACTCCTGTGCTGGCTACTTTACTTGGATATGTAGCTACATCCAAGGATCCGCTTGTCGGGGGCAGCCTCCTTTTGACATACACAACTGGCTACGTCGTGCCGCTACTGCTCGCTGCCTCGTTTGCTGGAGCATTGCAGAGCCTTCTGTCATTTCGAAAGTTCTCATCATGGATTAATCCTATAAGGTAA 1008 46.33 MSLLMSHSAGFGINSITIPTSKRLQIKARGKYFVPMKLLGRQSAAEDQSKDIELVENKNICNHFQAMAFVNAISATSFLAVDAAKAETVKDMWEGAASVYTLADGGIGDWFGGFLFSAGQQANVAVQDQLSALSFTSLAVIFGAGFVTSLSPCTLSVLPLTLGYIGAFGSGKSRTEVVGNSVAFSLGLATTLALLGIAASFAGKAYGQIGQGLPLAASGLAVIMGLNLLEVVELRLPSFFDNFDPRSAAANFPSSVQAYLAGLTFALAASPCSTPVLATLLGYVATSKDPLVGGSLLLTYTTGYVVPLLLAASFAGALQSLLSFRKFSSWINPIR 335
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
7 18284545 18289336 + Hsped.07g10890.1 Hepe07g1089 574484

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Hepe07g1089 335 Pfam Cytochrome C biogenesis protein transmembrane region 141 333 IPR003834 GO:0016020(InterPro)|GO:0017004(InterPro)
Hepe07g1089 335 PANTHER CYTOCHROME C-TYPE BIOGENESIS PROTEIN HI_1454-RELATED 103 334 IPR051790 -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Hepe07g1089 - - - - 0.0
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Hepe10g1213 . 1 448 Chloroplast and Mitochondria Gene Families AT2G28800 61.4 1.1e-140 496.9
Hepe10g0061 . 73 414 Chloroplast and Mitochondria Gene Families AT2G28800 56.9 7.3e-100 361.3
Hepe02g0760 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 80.8 4.7e-118 421.0
Hepe07g1785 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 9.8e-120 426.8
Hepe03g0532 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.3 2.4e-118 422.2
Hepe03g0533 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.3 2.4e-118 422.2
Hepe07g1783 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 74.8 7.0e-118 420.6
Hepe02g1178 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.1 1.2e-117 419.9
Hepe01g1350 . 3 264 Chloroplast and Mitochondria Gene Families AT3G27690 68.4 8.1e-98 354.0
Hepe07g1095 . 5 262 Chloroplast and Mitochondria Gene Families AT3G27690 67.4 3.1e-97 352.1
Hepe06g0214 . 72 275 Chloroplast and Mitochondria Gene Families AT3G27690 53.1 2.1e-53 206.5
Hepe10g1514 . 3 267 Chloroplast and Mitochondria Gene Families AT3G61470 80.9 5.0e-128 454.1
Hepe09g0945 . 61 266 Chloroplast and Mitochondria Gene Families AT3G61470 66.5 1.4e-85 313.2
Hepe09g0112 . 22 249 Chloroplast and Mitochondria Gene Families AT3G61470 51.7 5.0e-64 241.5
Hepe02g2965 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 82.1 1.2e-90 329.7
Hepe04g0768 . 2 287 Chloroplast and Mitochondria Gene Families AT3G08940 81.9 2.7e-135 478.4
Hepe01g2379 . 54 316 Chloroplast and Mitochondria Gene Families AT1G76570 81.7 9.7e-129 456.8
Hepe09g1201 . 1 271 Chloroplast and Mitochondria Gene Families AT1G61520 86.1 9.9e-135 476.5
Hepe07g1785 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 77.8 6.7e-120 427.2
Hepe07g1783 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 77.4 1.9e-119 425.6
Hepe03g0532 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 77.4 7.4e-119 423.7
Hepe03g0533 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 77.4 7.4e-119 423.7
Hepe02g1178 . 27 265 Chloroplast and Mitochondria Gene Families AT2G05070 83.7 8.2e-118 420.2
Hepe07g1095 . 8 262 Chloroplast and Mitochondria Gene Families AT2G05070 68.0 7.2e-98 354.0
Hepe01g1350 . 11 264 Chloroplast and Mitochondria Gene Families AT2G05070 68.4 4.7e-97 351.3
Hepe06g0214 . 72 275 Chloroplast and Mitochondria Gene Families AT2G05070 53.6 1.4e-53 206.8
Hepe07g1785 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 2.0e-102 369.4
Hepe07g1783 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.6 1.7e-101 366.3
Hepe03g0532 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.0 3.7e-101 365.2
Hepe03g0533 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.0 3.7e-101 365.2
Hepe02g1178 . 8 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.2 1.6e-99 359.8
Hepe07g1095 . 8 234 Chloroplast and Mitochondria Gene Families AT2G05100 67.6 1.3e-82 303.5
Hepe01g1350 . 11 236 Chloroplast and Mitochondria Gene Families AT2G05100 67.7 2.5e-81 299.3
Hepe06g0214 . 72 259 Chloroplast and Mitochondria Gene Families AT2G05100 51.8 1.4e-44 177.2
Hepe04g0768 . 1 169 Chloroplast and Mitochondria Gene Families AT2G40100 74.6 8.4e-69 256.9
Hepe03g0532 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 89.5 6.1e-137 483.8
Hepe03g0533 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 89.5 6.1e-137 483.8
Hepe07g1785 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.0 9.7e-135 476.5
Hepe07g1783 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 86.9 1.7e-134 475.7
Hepe02g1178 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29930 84.9 1.7e-126 449.1
Hepe01g1350 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29930 75.5 1.7e-94 342.8
Hepe07g1095 . 32 262 Chloroplast and Mitochondria Gene Families AT1G29930 69.8 2.9e-94 342.0
Hepe03g0534 . 1 103 Chloroplast and Mitochondria Gene Families AT1G29930 83.7 4.3e-42 168.7
Hepe03g0532 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 89.1 2.3e-136 481.9
Hepe03g0533 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 89.1 2.3e-136 481.9
Hepe07g1785 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.6 3.7e-134 474.6
Hepe07g1783 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 86.5 6.3e-134 473.8
Hepe02g1178 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29920 84.9 2.2e-126 448.7
Hepe01g1350 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29920 75.5 1.7e-94 342.8
Hepe07g1095 . 32 262 Chloroplast and Mitochondria Gene Families AT1G29920 69.8 2.9e-94 342.0
Hepe03g0534 . 1 103 Chloroplast and Mitochondria Gene Families AT1G29920 82.7 1.6e-41 166.8
Hepe03g0532 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 89.1 2.3e-136 481.9
Hepe03g0533 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 89.1 2.3e-136 481.9
Hepe07g1785 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.6 3.7e-134 474.6
Hepe07g1783 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 86.5 6.3e-134 473.8
Hepe02g1178 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29910 84.9 2.2e-126 448.7
Hepe01g1350 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29910 75.5 1.7e-94 342.8
Hepe07g1095 . 32 262 Chloroplast and Mitochondria Gene Families AT1G29910 69.8 2.9e-94 342.0
Hepe03g0534 . 1 103 Chloroplast and Mitochondria Gene Families AT1G29910 82.7 1.6e-41 166.8
Hepe06g0214 . 11 290 Chloroplast and Mitochondria Gene Families AT4G10340 84.3 2.4e-136 481.9
Hepe02g1178 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 53.6 6.5e-57 218.0
Hepe03g0532 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 51.6 6.5e-57 218.0
Hepe03g0533 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 51.6 6.5e-57 218.0
Hepe07g1785 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 6.5e-57 218.0
Hepe07g1783 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 51.1 8.5e-57 217.6
Hepe07g1095 . 44 250 Chloroplast and Mitochondria Gene Families AT4G10340 53.6 1.1e-51 200.7
Hepe01g1350 . 42 252 Chloroplast and Mitochondria Gene Families AT4G10340 51.4 3.1e-51 199.1
Hepe03g0532 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 3.7e-134 474.6
Hepe03g0533 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 3.7e-134 474.6
Hepe07g1785 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 86.9 5.8e-132 467.2
Hepe07g1783 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 85.8 9.9e-132 466.5
Hepe02g1178 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34420 84.9 4.8e-126 447.6
Hepe01g1350 . 46 264 Chloroplast and Mitochondria Gene Families AT2G34420 75.9 2.2e-94 342.4
Hepe07g1095 . 32 262 Chloroplast and Mitochondria Gene Families AT2G34420 70.2 2.8e-94 342.0
Hepe03g0534 . 1 103 Chloroplast and Mitochondria Gene Families AT2G34420 79.8 4.4e-39 158.7
Hepe03g0532 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 1.8e-136 482.3
Hepe03g0533 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 1.8e-136 482.3
Hepe07g1785 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.0 6.7e-136 480.3
Hepe07g1783 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 86.1 1.6e-134 475.7
Hepe02g1178 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34430 85.2 6.7e-128 453.8
Hepe01g1350 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34430 71.4 2.2e-94 342.4
Hepe07g1095 . 32 262 Chloroplast and Mitochondria Gene Families AT2G34430 71.0 2.8e-94 342.0
Hepe06g0214 . 72 275 Chloroplast and Mitochondria Gene Families AT2G34430 51.0 2.7e-52 202.6
Hepe03g0534 . 1 103 Chloroplast and Mitochondria Gene Families AT2G34430 79.6 2.1e-41 166.4
Hepe04g0768 . 4 287 Chloroplast and Mitochondria Gene Families AT5G01530 83.2 2.7e-138 488.4
Hepe07g0576 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.1 6.1e-142 500.4
Hepe07g0576 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 84.5 8.8e-148 520.0
Hepe08g0701 . 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 73.8 2.7e-142 501.9
Hepe04g0728 . 10 307 Chloroplast and Mitochondria Gene Families AT2G30160 66.0 4.6e-110 394.8
Hepe08g0701 . 5 327 Chloroplast and Mitochondria Gene Families AT1G07030 75.2 1.0e-141 500.0
Hepe04g0728 . 6 307 Chloroplast and Mitochondria Gene Families AT1G07030 69.2 2.9e-117 418.7
Hepe03g1870 . 1 340 Chloroplast and Mitochondria Gene Families AT2G47490 69.6 1.8e-132 469.2
Hepe02g2690 . 1 317 Chloroplast and Mitochondria Gene Families AT2G47490 61.9 8.2e-109 390.6
Hepe02g2690 . 9 357 Chloroplast and Mitochondria Gene Families AT1G25380 63.4 2.4e-120 429.1
Hepe03g1870 . 11 332 Chloroplast and Mitochondria Gene Families AT1G25380 57.8 7.3e-101 364.4
Hepe07g1961 . 6 584 Chloroplast and Mitochondria Gene Families AT4G21490 74.5 2.3e-258 888.3
Hepe08g0511 . 5 584 Chloroplast and Mitochondria Gene Families AT4G21490 69.2 2.8e-240 828.2
Hepe02g0166 . 4 574 Chloroplast and Mitochondria Gene Families AT4G21490 64.9 6.4e-224 773.9
Hepe09g1483 . 10 179 Chloroplast and Mitochondria Gene Families AT1G17530 59.3 1.3e-50 196.4
Hepe09g1483 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 58.4 6.1e-51 197.6
Hepe09g1483 . 5 183 Chloroplast and Mitochondria Gene Families AT1G72750 58.8 2.9e-53 205.3
Hepe10g1863 . 9 243 Chloroplast and Mitochondria Gene Families AT1G26100 60.0 7.1e-73 270.8
Hepe02g3250 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 68.3 7.7e-88 320.5
Hepe06g1255 . 23 233 Chloroplast and Mitochondria Gene Families AT4G25570 66.8 8.4e-81 297.4
Hepe02g2597 . 5 222 Chloroplast and Mitochondria Gene Families AT1G14730 51.4 3.7e-63 238.4
Hepe02g2492 . 6 366 Chloroplast and Mitochondria Gene Families AT5G14040 81.2 1.4e-171 599.4
Hepe02g1660 . 11 371 Chloroplast and Mitochondria Gene Families AT5G14040 75.8 3.0e-158 555.1
Hepe02g0359 . 11 303 Chloroplast and Mitochondria Gene Families AT5G14040 52.2 3.1e-86 315.8
Hepe02g1660 . 8 371 Chloroplast and Mitochondria Gene Families AT3G48850 69.8 3.1e-144 508.4
Hepe02g2492 . 8 364 Chloroplast and Mitochondria Gene Families AT3G48850 69.6 2.9e-142 501.9
Hepe02g0359 . 11 303 Chloroplast and Mitochondria Gene Families AT3G48850 51.5 1.6e-87 320.1
Hepe02g0359 . 14 308 Chloroplast and Mitochondria Gene Families AT2G17270 75.9 3.1e-132 468.4
Hepe02g1660 . 63 370 Chloroplast and Mitochondria Gene Families AT2G17270 50.6 1.5e-86 316.6
Hepe02g2492 . 64 361 Chloroplast and Mitochondria Gene Families AT2G17270 51.7 5.6e-86 314.7
Hepe02g3214 . 16 319 Chloroplast and Mitochondria Gene Families AT5G15640 75.2 1.1e-129 459.9
Hepe05g1353 . 17 319 Chloroplast and Mitochondria Gene Families AT5G15640 50.5 8.1e-80 294.3
Hepe01g1906 . 12 344 Chloroplast and Mitochondria Gene Families AT5G26200 67.3 1.1e-122 436.8
Hepe03g1443 . 1 344 Chloroplast and Mitochondria Gene Families AT5G26200 57.4 2.1e-105 379.4
Hepe03g1443 . 1 348 Chloroplast and Mitochondria Gene Families AT1G72820 76.4 1.0e-147 520.0
Hepe01g1906 . 1 347 Chloroplast and Mitochondria Gene Families AT1G72820 69.1 6.7e-128 454.1
Hepe06g1518 . 78 283 Chloroplast and Mitochondria Gene Families AT5G52570 53.9 2.0e-51 199.5
Hepe07g0127 . 1 215 Chloroplast and Mitochondria Gene Families AT4G25700 65.3 6.3e-71 264.2
Hepe06g1518 . 39 200 Chloroplast and Mitochondria Gene Families AT4G25700 64.3 2.1e-58 222.6
Hepe02g0164 . 109 302 Chloroplast and Mitochondria Gene Families AT4G03320 51.3 3.2e-59 225.7
Hepe07g1089 . 12 334 Chloroplast and Mitochondria Gene Families AT5G54290 67.0 5.4e-109 391.3
Hepe09g0521 . 33 542 Chloroplast and Mitochondria Gene Families AT2G18710 83.0 7.9e-240 826.6
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0012624 0 2 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 1 1 1 1 1 1 1 1 1 1 1 2 1 29