Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Lac10g0087 ATGGCAACTGTCATGACACAGGCTTCAGTCGCCGTCTTTAGGCCATGCACGTCAAGGACGAGGTTCCTTTCGGGTTCGTCGGAAAAGTTTAACAGAGCTTTGTCTGTTAAGCCAACAACTTCTTCAGTTCCCAGTTCTTTCAAAGTTGAGGCCAAGAAAGGAGAGTGGTTACCAGGTTTGCCATCCCCAGCTTACCTTGATGGCAGTCTTCCAGGTGACAACGGATTTGATCCTCTAGGACTTGCAGAGGACCCTGAGAACTTGAAGTGGTATGTGCAAGCAGAGCTTGTGAATGGTCGGTGGGCGATGCTCGGAGTTGCAGGTATGCTATTGCCTGAAGTCTTCACAAGTTTTGGAATCATCAACGTACCGAAATGGTACGATGCTGGGAAAGCCGAGTATTTCGCATCATCGTCAACTCTCTTTGTGATCGAGTTCATTCTGTTCCACTATGTGGAAATCAGAAGATGGCAAGACATAAAGAACCCAGGAAGTGTAAACCAAGATCCCATTTTCAAGCAATACAGCTTGCCACCAAATGATGTTGGATACCCAGGGGGGATTTTCAACCCACTCAACTTTGAACCAACTCTTGAGGCCAAGGAAAAGGAGATTGCTAATGGGAGATTGGCAATGTTGGCATTCTTGGGATTCATTGTTCAACACAATGTGACAGGAAAAGGTCCATTTGACAACTTCTTGCAGCACATTTCAGACCCATGGCACAACACCATTATCCAAACACTAAGGGGATAA 756 46.16 MATVMTQASVAVFRPCTSRTRFLSGSSEKFNRALSVKPTTSSVPSSFKVEAKKGEWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLKWYVQAELVNGRWAMLGVAGMLLPEVFTSFGIINVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNDVGYPGGIFNPLNFEPTLEAKEKEIANGRLAMLAFLGFIVQHNVTGKGPFDNFLQHISDPWHNTIIQTLRG 251
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
10 677428 678349 - Lag0024132.1 Lac10g0087 582618

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Lac10g0087 251 SUPERFAMILY Chlorophyll a-b binding protein 53 249 - -
Lac10g0087 251 Gene3D Chlorophyll a/b binding protein domain 63 242 - -
Lac10g0087 251 Pfam Chlorophyll A-B binding protein 63 222 IPR022796 -
Lac10g0087 251 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 9 245 IPR001344 GO:0009416(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0016020(InterPro)
Lac10g0087 251 FunFam Chlorophyll a-b binding protein, chloroplastic 63 242 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lac10g0087 K08910 - - csv:101218675 479.559
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Lac10g0087 Lac-Chr10:677428 Lac2g0020 Lac-Chr2:209409 7.20E-32 dispersed
Lac13g0050 Lac-Chr13:357170 Lac10g0087 Lac-Chr10:677428 5.00E-62 transposed
Lac3g1509 Lac-Chr3:13926876 Lac10g0087 Lac-Chr10:677428 2.40E-41 transposed
Lac6g0319 Lac-Chr6:2619212 Lac10g0087 Lac-Chr10:677428 4.00E-57 transposed
Lac8g2422 Lac-Chr8:42322227 Lac10g0087 Lac-Chr10:677428 5.40E-40 transposed
Lac10g0087 Lac-Chr10:677428 Lac3g0610 Lac-Chr3:4737376 3.60E-132 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi17g566 Blo04g00773 . Bda06g00542 Bda15g00608 Bpe12g00541 . . Bma12g00994 . . . Cma11g00139 Car10g00187 Car11g00156 . . Cpe04g01495 . . . . . . . Cla06g01586 Cam06g1755 Cec06g1811 Cco06g1814 Clacu06g1721 Cmu06g1664 Cre06g2478 Cone2ag0840 Cone16ag0175 . . Lsi02g00081 Csa01g00560 Chy12g01533 Cme12g01983 Blo13g00003 Blo15g00312 . . Bpe07g00779 . . Bma08g00227 Sed08g2078 Cmo10g00213 Cmo11g00172 . . . . . Cpe18g00788 Bhi08g01147 Tan05g2431 Cmetu02g0368 Lac10g0087 Hepe07g2501 . . Cla04g01190 Cam04g1247 Cec01g1758 Cco01g1804 Clacu04g1276 Cmu04g1254 Cre01g1547 . Csa01g00241 Chy02g02491 Cme02g01877
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lac7g2695 . 1 387 Chloroplast and Mitochondria Gene Families AT2G28800 66.3 5.4e-136 481.9
Lac6g0708 . 71 426 Chloroplast and Mitochondria Gene Families AT2G28800 55.2 2.8e-100 363.2
Lac6g0701 . 74 320 Chloroplast and Mitochondria Gene Families AT2G28800 51.4 4.4e-61 233.0
Lac8g1690 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 80.8 8.8e-118 420.6
Lac12g0377 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 89.8 2.2e-144 509.2
Lac9g2258 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 78.0 9.8e-121 430.6
Lac1g3495 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 2.2e-120 429.5
Lac10g1066 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.4 2.4e-119 426.0
Lac11g0445 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.2 3.2e-119 425.6
Lac5g1661 . 5 265 Chloroplast and Mitochondria Gene Families AT3G27690 67.4 5.2e-98 355.1
Lac2g2682 . 112 315 Chloroplast and Mitochondria Gene Families AT3G27690 51.7 9.7e-52 201.4
Lac13g0050 . 70 305 Chloroplast and Mitochondria Gene Families AT3G61470 85.7 1.4e-123 439.9
Lac3g0610 . 22 249 Chloroplast and Mitochondria Gene Families AT3G61470 51.7 8.6e-65 244.6
Lac10g0087 . 22 245 Chloroplast and Mitochondria Gene Families AT3G61470 51.1 1.4e-62 237.3
Lac6g0319 . 46 256 Chloroplast and Mitochondria Gene Families AT3G61470 50.9 2.4e-54 209.9
Lac8g2422 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 82.1 4.9e-90 328.2
Lac1g1888 . 59 346 Chloroplast and Mitochondria Gene Families AT3G08940 82.7 2.7e-136 482.3
Lac10g3209 . 112 359 Chloroplast and Mitochondria Gene Families AT3G08940 85.5 1.7e-122 436.4
Lac2g0020 . 26 250 Chloroplast and Mitochondria Gene Families AT1G76570 80.9 6.1e-116 414.8
Lac3g1509 . 1 273 Chloroplast and Mitochondria Gene Families AT1G61520 85.7 6.4e-135 477.6
Lac12g0377 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.8 3.3e-144 508.4
Lac9g2258 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 79.3 5.7e-120 427.9
Lac1g3495 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 7.4e-120 427.6
Lac10g1066 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 1.3e-119 426.8
Lac11g0445 . 27 265 Chloroplast and Mitochondria Gene Families AT2G05070 83.7 1.2e-117 420.2
Lac5g1661 . 8 265 Chloroplast and Mitochondria Gene Families AT2G05070 68.0 1.2e-98 357.1
Lac2g2682 . 112 315 Chloroplast and Mitochondria Gene Families AT2G05070 52.2 6.6e-52 201.8
Lac12g0377 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.9 1.8e-125 446.4
Lac9g2258 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 77.8 4.1e-101 365.5
Lac1g3495 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.9 5.4e-101 365.2
Lac10g1066 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.4 5.4e-101 365.2
Lac11g0445 . 8 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.6 1.0e-99 360.9
Lac5g1661 . 8 237 Chloroplast and Mitochondria Gene Families AT2G05100 67.6 3.0e-83 306.2
Lac2g2682 . 112 299 Chloroplast and Mitochondria Gene Families AT2G05100 50.8 2.3e-43 173.7
Lac1g1888 . 61 228 Chloroplast and Mitochondria Gene Families AT2G40100 73.8 1.6e-68 256.5
Lac10g3209 . 94 244 Chloroplast and Mitochondria Gene Families AT2G40100 63.5 5.1e-51 198.4
Lac9g2258 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 89.2 5.1e-137 484.6
Lac1g3495 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 89.1 3.3e-136 481.9
Lac10g1066 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.0 5.7e-136 481.1
Lac11g0445 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29930 85.3 3.1e-126 448.7
Lac12g0377 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29930 78.3 3.8e-116 415.2
Lac5g1661 . 35 265 Chloroplast and Mitochondria Gene Families AT1G29930 70.2 1.4e-94 343.6
Lac9g2258 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 89.2 8.8e-137 483.8
Lac1g3495 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.8 1.3e-135 479.9
Lac10g1066 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.6 2.2e-135 479.2
Lac11g0445 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29920 85.3 4.1e-126 448.4
Lac12g0377 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29920 77.9 2.2e-116 416.0
Lac5g1661 . 35 265 Chloroplast and Mitochondria Gene Families AT1G29920 70.2 1.4e-94 343.6
Lac9g2258 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 89.2 8.8e-137 483.8
Lac1g3495 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.8 1.3e-135 479.9
Lac10g1066 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.6 2.2e-135 479.2
Lac11g0445 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29910 85.3 4.1e-126 448.4
Lac12g0377 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29910 77.9 2.2e-116 416.0
Lac5g1661 . 35 265 Chloroplast and Mitochondria Gene Families AT1G29910 70.2 1.4e-94 343.6
Lac2g2682 . 50 330 Chloroplast and Mitochondria Gene Families AT4G10340 84.7 8.3e-138 487.3
Lac10g1066 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 7.2e-57 218.4
Lac1g3495 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 1.2e-56 217.6
Lac9g2258 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.6e-56 217.2
Lac11g0445 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.6e-56 217.2
Lac12g0377 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 4.4e-54 209.1
Lac5g1661 . 47 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 7.0e-52 201.8
Lac9g2258 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 89.2 3.3e-136 481.9
Lac10g1066 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 1.1e-134 476.9
Lac1g3495 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 1.4e-134 476.5
Lac11g0445 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34420 85.7 6.3e-127 451.1
Lac12g0377 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 77.2 7.7e-117 417.5
Lac5g1661 . 35 265 Chloroplast and Mitochondria Gene Families AT2G34420 70.7 1.4e-94 343.6
Lac1g3495 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 89.9 1.9e-136 482.6
Lac10g1066 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 2.5e-136 482.3
Lac9g2258 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 88.1 9.7e-136 480.3
Lac11g0445 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34430 86.0 8.8e-129 457.2
Lac12g0377 . 31 265 Chloroplast and Mitochondria Gene Families AT2G34430 83.2 2.1e-114 409.5
Lac5g1661 . 35 265 Chloroplast and Mitochondria Gene Families AT2G34430 71.4 1.4e-94 343.6
Lac1g1888 . 60 346 Chloroplast and Mitochondria Gene Families AT5G01530 82.6 5.0e-138 488.0
Lac10g3209 . 128 359 Chloroplast and Mitochondria Gene Families AT5G01530 91.8 1.7e-125 446.4
Lac5g1846 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.8 9.4e-144 506.9
Lac5g1846 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 85.8 7.9e-150 527.3
Lac9g2357 . 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 76.2 1.4e-144 510.0
Lac1g1832 . 9 310 Chloroplast and Mitochondria Gene Families AT2G30160 68.4 2.1e-116 416.4
Lac9g2357 . 5 327 Chloroplast and Mitochondria Gene Families AT1G07030 76.4 2.2e-142 502.7
Lac1g1832 . 5 310 Chloroplast and Mitochondria Gene Families AT1G07030 71.1 1.1e-122 437.2
Lac4g2489 . 1 305 Chloroplast and Mitochondria Gene Families AT2G47490 76.4 5.3e-133 471.5
Lac8g1479 . 11 311 Chloroplast and Mitochondria Gene Families AT2G47490 62.5 5.9e-108 388.3
Lac8g1479 . 10 361 Chloroplast and Mitochondria Gene Families AT1G25380 65.1 7.2e-126 448.0
Lac4g2489 . 11 297 Chloroplast and Mitochondria Gene Families AT1G25380 63.8 4.6e-104 375.6
Lac10g0805 . 5 583 Chloroplast and Mitochondria Gene Families AT4G21490 74.5 1.1e-256 883.2
Lac9g2123 . 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 69.3 2.7e-239 825.5
Lac12g0676 . 4 574 Chloroplast and Mitochondria Gene Families AT4G21490 64.2 6.6e-222 767.7
Lac4g2996 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 64.9 6.4e-62 234.6
Lac3g2041 . 4 179 Chloroplast and Mitochondria Gene Families AT1G17530 59.0 1.3e-51 200.3
Lac3g2041 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 58.4 5.2e-51 198.4
Lac4g2996 . 22 186 Chloroplast and Mitochondria Gene Families AT3G04800 54.5 2.2e-41 166.4
Lac4g2996 . 15 186 Chloroplast and Mitochondria Gene Families AT1G72750 68.9 6.5e-62 234.6
Lac3g2041 . 5 183 Chloroplast and Mitochondria Gene Families AT1G72750 58.8 5.5e-53 204.9
Lac13g0449 . 80 275 Chloroplast and Mitochondria Gene Families AT1G26100 64.3 8.2e-70 261.2
Lac8g2802 . 46 271 Chloroplast and Mitochondria Gene Families AT5G38630 70.5 5.3e-90 328.2
Lac11g0019 . 23 218 Chloroplast and Mitochondria Gene Families AT4G25570 69.4 6.1e-80 295.0
Lac3g0033 . 24 339 Chloroplast and Mitochondria Gene Families AT5G14040 83.3 2.9e-154 542.3
Lac8g2062 . 9 351 Chloroplast and Mitochondria Gene Families AT5G14040 75.0 1.8e-151 533.1
Lac8g0058 . 9 369 Chloroplast and Mitochondria Gene Families AT5G14040 66.9 1.3e-130 463.8
Lac12g0462 . 11 298 Chloroplast and Mitochondria Gene Families AT5G14040 51.7 2.4e-84 310.1
Lac3g0033 . 6 339 Chloroplast and Mitochondria Gene Families AT3G48850 68.9 4.0e-140 495.4
Lac8g2062 . 8 340 Chloroplast and Mitochondria Gene Families AT3G48850 67.3 7.0e-129 458.0
Lac8g0058 . 6 369 Chloroplast and Mitochondria Gene Families AT3G48850 61.5 9.5e-118 421.0
Lac12g0462 . 11 299 Chloroplast and Mitochondria Gene Families AT3G48850 50.9 2.4e-84 310.1
Lac12g0462 . 8 308 Chloroplast and Mitochondria Gene Families AT2G17270 74.5 1.3e-131 466.8
Lac3g0033 . 43 341 Chloroplast and Mitochondria Gene Families AT2G17270 50.7 2.4e-85 313.2
Lac8g2759 . 16 312 Chloroplast and Mitochondria Gene Families AT5G15640 77.3 1.8e-128 456.4
Lac2g0482 . 12 345 Chloroplast and Mitochondria Gene Families AT5G26200 67.7 5.8e-125 444.9
Lac4g3001 . 1 341 Chloroplast and Mitochondria Gene Families AT5G26200 58.1 3.9e-105 379.0
Lac4g3001 . 1 345 Chloroplast and Mitochondria Gene Families AT1G72820 76.8 7.6e-149 524.2
Lac2g0482 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 68.2 1.5e-128 456.8
Lac11g2058 . 91 296 Chloroplast and Mitochondria Gene Families AT5G52570 52.9 2.5e-50 196.4
Lac5g2972 . 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 63.3 3.9e-69 258.8
Lac11g2058 . 28 213 Chloroplast and Mitochondria Gene Families AT4G25700 61.7 3.6e-59 225.7
Lac5g1674 . 52 358 Chloroplast and Mitochondria Gene Families AT5G54290 74.8 4.4e-120 428.7
Lac3g0269 . 53 542 Chloroplast and Mitochondria Gene Families AT2G18710 85.0 3.4e-236 815.1
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0001994 2 2 3 3 2 2 3 2 2 2 2 2 3 2 2 3 2 2 3 2 2 2 2 2 2 2 2 3 2 1 66