Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Lac10g3026 ATGAGCGTGATTGACCTGTTGACCAGAGTAGATGCGATCTGCCAGAAGTACGACAAATACGATGTAGAGAAGCAGAGGGATCTCAATGTCTCCGGCGATGATGCCTTTGCTCGACTCTATGCCACCGTCGAAGCCGACATTGAAGCCGCTCTTCAGAAAGCGGATGATGCTTCTAAAGAGAAGAATAGGGCGTCGGTGGTGGCGTTGAATGCGGAGATTCGTCGTACCAAGGCTCGATTACTGGAGGAGGTCCCCAAGTTGCAGAGATTGGCTGTAAAGAGGGTAAAAGGACTATCAACTGAAGATCTTACCACTCGAAATGATTTGGTGCTTGCATTGCCGGATCGGATTCAAGCTATACCAGATGGGACTGCTACTGCAGCGAAGAAGAATGGTGGTTGGACATCCTCAGCTTCACGTACTGAAATAAAATTTGACTCAGATGGGCGATTTGATGATGAGTACTTCCAACACACTGAGGAGTCAAGTCAGTTCAGGCAAGAGTATGAAATGCGGAAAATGAAACAGGATCAAGGATTGGACATGATATCCGAAGGGTTGGATACTCTGAAGAACATGGCTCATGACATGAATGAGGAAATAGACAGGCAAGTTCCTTTGATGGACGAGATTGACACTAAGGTGGACAAAGCTGCATCTGACCTTAAAAACACCAATGTTAGATTAAAGGACACAGTTAACCAGCTAAGGTCCAGCAGAAATTTCTGTATTGATATTGTTTTGTTGTGTATAATCTTGGGTATTGCTGCCTATCTATACAAGTGGTGCTTTAGGCAAGTGCAACTGAACTCTATTATGGAATGTGGGAAGTGTATGGTAGCATTAAGAGTTCATGAGTCAGATCCTACCTAG 873 44.79 MSVIDLLTRVDAICQKYDKYDVEKQRDLNVSGDDAFARLYATVEADIEAALQKADDASKEKNRASVVALNAEIRRTKARLLEEVPKLQRLAVKRVKGLSTEDLTTRNDLVLALPDRIQAIPDGTATAAKKNGGWTSSASRTEIKFDSDGRFDDEYFQHTEESSQFRQEYEMRKMKQDQGLDMISEGLDTLKNMAHDMNEEIDRQVPLMDEIDTKVDKAASDLKNTNVRLKDTVNQLRSSRNFCIDIVLLCIILGIAAYLYKWCFRQVQLNSIMECGKCMVALRVHESDPT 290
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
10 44824372 44826782 - Lag0027071.1 Lac10g3026 585557

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Lac10g3026 290 CDD SNARE_Qc 175 230 - -
Lac10g3026 290 Pfam SNARE domain 207 256 IPR000727 -
Lac10g3026 290 ProSitePatterns Syntaxin / epimorphin family signature. 176 215 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Lac10g3026 290 FunFam Putative syntaxin-71-like 170 231 - -
Lac10g3026 290 Coils Coil 219 239 - -
Lac10g3026 290 Coils Coil 40 60 - -
Lac10g3026 290 SMART tSNARE_6 165 232 IPR000727 -
Lac10g3026 290 Gene3D - 170 231 - -
Lac10g3026 290 PANTHER SYNTAXIN 44 250 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0006886(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Lac10g3026 290 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 170 232 IPR000727 -
Lac10g3026 290 SUPERFAMILY SNARE fusion complex 163 230 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lac10g3026 K08506 - - csv:101215905 496.893
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Lac1g1934 Lac-Chr1:40992214 Lac10g3026 Lac-Chr10:44824372 1.90E-33 transposed
Lac10g3026 Lac-Chr10:44824372 Lac9g2572 Lac-Chr9:44322461 1.40E-100 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi8g590 . . . . Bpe04g01584 . . . . Cmo14g00195 . . . . . . . . . . . . . . . . . . . . . . . Cone13ag1275 Cone19ag1262 . . . Cme04g02538 . . . . . . . . Sed04g1347 . . . Cma14g00203 . Car14g00181 Cpe03g00174 . Bhi11g02112 Tan08g1893 Cmetu04g1845 Lac10g3026 Hepe05g0250 . . Cla10g01938 Cam10g2004 Cec10g2046 Cco10g2031 Clacu10g2011 Cmu10g2760 Cre10g2153 Lsi03g02035 Csa03g03265 Chy04g02075 .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lac6g1229 . 64 344 SNARE and Associated Proteins AT3G24350 63.7 7.1e-81 298.5
Lac1g1718 . 1 308 SNARE and Associated Proteins AT1G08560 69.6 8.7e-104 374.4
Lac1g2924 . 1 305 SNARE and Associated Proteins AT2G18260 55.6 1.6e-86 317.0
Lac10g2747 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.8e-115 412.1
Lac1g2321 . 30 283 SNARE and Associated Proteins AT3G11820 72.4 7.0e-101 364.8
Lac10g0809 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 4.5e-92 335.5
Lac10g2747 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 9.3e-91 331.3
Lac1g2321 . 35 283 SNARE and Associated Proteins AT3G52400 65.1 3.4e-85 312.8
Lac10g0809 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 5.1e-81 298.9
Lac10g0809 . 1 299 SNARE and Associated Proteins AT4G03330 68.5 1.7e-107 386.7
Lac10g2747 . 1 279 SNARE and Associated Proteins AT4G03330 57.5 8.3e-83 304.7
Lac1g2321 . 1 288 SNARE and Associated Proteins AT4G03330 54.2 3.3e-79 292.7
Lac10g0809 . 1 303 SNARE and Associated Proteins AT1G61290 78.9 3.8e-128 455.3
Lac10g2747 . 1 279 SNARE and Associated Proteins AT1G61290 62.3 4.8e-91 332.0
Lac1g2321 . 1 288 SNARE and Associated Proteins AT1G61290 55.9 5.4e-82 302.0
Lac10g0809 . 1 303 SNARE and Associated Proteins AT1G11250 77.2 1.1e-124 443.7
Lac10g2747 . 1 279 SNARE and Associated Proteins AT1G11250 63.1 1.3e-93 340.5
Lac1g2321 . 1 288 SNARE and Associated Proteins AT1G11250 56.9 5.1e-85 312.0
Lac7g1748 . 3 342 SNARE and Associated Proteins AT3G03800 57.2 6.2e-94 341.7
Lac9g2066 . 34 255 SNARE and Associated Proteins AT3G03800 59.9 4.0e-69 259.2
Lac7g1748 . 3 259 SNARE and Associated Proteins AT5G08080 60.7 2.8e-72 269.2
Lac9g2066 . 6 206 SNARE and Associated Proteins AT5G08080 59.7 1.0e-53 207.6
Lac5g0200 . 1 256 SNARE and Associated Proteins AT5G16830 59.2 5.8e-75 278.5
Lac5g0200 . 1 256 SNARE and Associated Proteins AT5G46860 66.8 1.5e-80 297.0
Lac5g0200 . 1 256 SNARE and Associated Proteins AT4G17730 61.3 2.3e-73 273.1
Lac5g0200 . 65 256 SNARE and Associated Proteins AT1G32270 60.4 3.8e-52 203.0
Lac13g1100 . 1 334 SNARE and Associated Proteins AT5G05760 66.3 1.1e-112 404.1
Lac6g1229 . 64 344 SNARE and Associated Proteins AT3G24350 63.7 7.1e-81 298.5
Lac6g2561 . 1 294 SNARE and Associated Proteins AT5G26980 75.5 9.0e-112 401.0
Lac4g2493 . 1 312 SNARE and Associated Proteins AT5G26980 66.6 1.4e-101 367.1
Lac4g2493 . 1 311 SNARE and Associated Proteins AT4G02195 65.9 5.0e-102 368.6
Lac6g2561 . 1 294 SNARE and Associated Proteins AT4G02195 65.2 3.2e-93 339.3
Lac6g2561 . 1 294 SNARE and Associated Proteins AT3G05710 73.2 1.6e-111 400.2
Lac4g2493 . 1 312 SNARE and Associated Proteins AT3G05710 62.8 4.2e-96 349.0
Lac2g1436 . 97 329 SNARE and Associated Proteins AT1G16240 71.7 3.5e-89 325.5
Lac5g1038 . 4 188 SNARE and Associated Proteins AT1G16240 69.2 1.4e-66 250.4
Lac2g1436 . 78 329 SNARE and Associated Proteins AT1G79590 66.7 3.0e-89 325.9
Lac5g1038 . 2 188 SNARE and Associated Proteins AT1G79590 69.5 5.4e-70 261.9
Lac2g1404 . 92 282 SNARE and Associated Proteins AT1G28490 71.2 7.9e-66 247.7
Lac10g3026 . 1 261 SNARE and Associated Proteins AT3G09740 79.1 1.4e-110 396.7
Lac9g2572 . 1 263 SNARE and Associated Proteins AT3G09740 67.5 4.1e-94 342.0
Lac9g2572 . 1 263 SNARE and Associated Proteins AT3G45280 65.3 1.7e-87 320.1
Lac10g3026 . 1 261 SNARE and Associated Proteins AT3G45280 64.4 6.4e-87 318.2
Lac10g3026 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 1.6e-95 346.7
Lac9g2572 . 1 263 SNARE and Associated Proteins AT3G61450 60.2 2.2e-84 309.7
Lac8g2909 . 249 469 SNARE and Associated Proteins AT1G51740 68.5 4.2e-77 285.4
Lac6g0895 . 319 458 SNARE and Associated Proteins AT1G51740 63.1 9.2e-40 161.4
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002038 1 2 1 1 1 2 3 2 2 2 2 2 3 3 2 3 2 2 3 2 3 2 2 2 2 2 3 2 2 2 63