Gene search
Sequence information
| Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
|---|---|---|---|---|---|---|
| Lac13g0190 | ATGATAATTCCGGTGCGCTGTTTCACGTGCGGCAAGGTGATCGGTAACAAATGGGACACTTATCTTGAACTTCTACAAGCAGACTATCCGGAAGGGGAGGCATTGGATATGTTAGGGCTAGTTCGATACTGCTGCCGGCGGATGCTTATGACTCATGTGGATCTCATAGAGAAGCTCTTGAATTACAACACTGATGAGGAAGCCTTTCGATATGCCAACAAGAAGAATGCTGCAATGCAATGCAATGCTGTGTAA | 255 | 45.88 | MIIPVRCFTCGKVIGNKWDTYLELLQADYPEGEALDMLGLVRYCCRRMLMTHVDLIEKLLNYNTDEEAFRYANKKNAAMQCNAV | 84 |
Gff information
| Chromosome | Start | End | Strand | Old_gene | Gene | Num |
|---|---|---|---|---|---|---|
| 13 | 1335332 | 1336063 | - | Lag0039986.1 | Lac13g0190 | 591346 |
Annotation
| Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
|---|---|---|---|---|---|---|---|---|
| Lac13g0190 | 84 | ProSitePatterns | RNA polymerases N / 8 Kd subunits signature. | 2 | 11 | IPR020789 | GO:0003677(InterPro)|GO:0003899(InterPro)|GO:0006351(InterPro)|GO:0008270(InterPro) | |
| Lac13g0190 | 84 | Pfam | RNA polymerases N / 8 kDa subunit | 2 | 59 | IPR000268 | GO:0003677(InterPro)|GO:0003899(InterPro)|GO:0006351(InterPro) | |
| Lac13g0190 | 84 | PANTHER | DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC5 FAMILY MEMBER | 1 | 67 | IPR000268 | GO:0001054(PANTHER)|GO:0001055(PANTHER)|GO:0001056(PANTHER)|GO:0003677(InterPro)|GO:0003899(InterPro)|GO:0003899(PANTHER)|GO:0005665(PANTHER)|GO:0005666(PANTHER)|GO:0005736(PANTHER)|GO:0006351(InterPro)|GO:0006360(PANTHER)|GO:0006366(PANTHER)|GO:0008270(PANTHER)|GO:0042797(PANTHER) | |
| Lac13g0190 | 84 | FunFam | DNA-directed RNA polymerases I, II, and III subunit | 1 | 69 | - | - | |
| Lac13g0190 | 84 | Hamap | DNA-directed RNA polymerase subunit Rpo10 [rpo10]. | 2 | 56 | IPR000268 | GO:0003677(InterPro)|GO:0003899(InterPro)|GO:0006351(InterPro) | |
| Lac13g0190 | 84 | Gene3D | - | 1 | 67 | - | - | |
| Lac13g0190 | 84 | SUPERFAMILY | RNA polymerase subunit RPB10 | 1 | 63 | IPR023580 | - |
Pathway
| Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
|---|---|---|---|---|---|---|
| Lac13g0190 | K03007 | - | - | csv:101211391 | 138.272 |
Dupl-types
| Select | Gene1 | Location1 | Gene2 | Location2 | E-value | Duplicated-type |
|---|---|---|---|---|---|---|
| Lac13g0190 | Lac-Chr13:1335332 | Lac6g1319 | Lac-Chr6:13622996 | 5.90E-31 | wgd |
Deco-Alignment
| Select | Vvi1 | Blo1 | Blo2 | Bda1 | Bda2 | Bpe1 | Bpe2 | Bma1 | Bma2 | Cmo1 | Cmo2 | Cma1 | Cma2 | Car1 | Car2 | Sed1 | Cpe1 | Cpe2 | Bhi1 | Tan1 | Cmetu1 | Lac1 | Hepe1 | Mch1 | Lcy1 | Cla1 | Cam1 | Cec1 | Cco1 | Clacu1 | Cmu1 | Cre1 | Cone1 | Cone2 | Cone3 | Cone4 | Lsi1 | Csa1 | Chy1 | Cme1 | Blo3 | Blo4 | Bda3 | Bda4 | Bpe3 | Bpe4 | Bma3 | Bma4 | Sed2 | Cmo3 | Cmo4 | Cma3 | Cma4 | Car3 | Car4 | Cpe3 | Cpe4 | Bhi2 | Tan2 | Cmetu2 | Lac2 | Hepe2 | Mch2 | Lcy2 | Cla2 | Cam2 | Cec2 | Cco2 | Clacu2 | Cmu2 | Cre2 | Lsi2 | Csa2 | Chy2 | Cme2 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Vvi1g671 | . | . | . | . | . | Bpe10g00844 | Bma14g01802 | Bma15g00179 | . | . | . | . | . | . | Sed07g2568 | . | . | Bhi07g01744 | Tan04g0166 | Cmetu10g0943 | Lac13g0190 | Hepe10g0024 | . | . | Cla05g02552 | Cam05g2740 | Cec05g2772 | Cco05g2812 | Clacu05g2741 | . | . | . | . | . | . | Lsi04g00560 | Csa05g02326 | Chy10g00893 | Cme10g00536 | Blo06g00883 | . | Bda07g01611 | . | . | . | . | . | . | . | . | . | . | . | . | . | . | . | . | . | . | . | . | . | . | . | . | . | . | . | . | . | . | . | . |