Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Lac1g1718 ATGAACGACTTGATGACCAAATCCTTCACCAGCTATGTCGATCTGAAGAAGGCCGCCATGAAAGACATCGACCTCGAAGCCGGTCTAGAAATGGCGTCGTCCGCTACCGACAACGGCGACATGGGCCTCTTCCTGGAAGAGGCCGAGAAGGTGAAAATGGAGATGGGTTCGATCAGAGAGATTCTGGGAAAGCTCCAGCAGGCCAATGAGGAGACTAAGTCTGCTCACAAACCAGAAACTCTCAAATCGCTTCGAAATACGATTAACGTCGACATCGTCACGGTCCTGAAGAAGGCGCGGTCGATCCGATCCCAGCTCGAGGAAATGGACCGTGCCAATGCTGCCAAGAAGAGGCTCTCCGGCAGCAAAGAGGGCACTGCCATTTACAGGACCCGAATCGCGGTGACGAACGGGCTGCGAAAGAAGTTAAAGGAACTGATGATGGAGTTTCAGAGCCTAAGGCAGAGGATGATGACGGAGTACAAGGAGACGGTAGGGCGACGATACTTCACGGTGACGGGAGAGCAACCGGAGGAGGAGGTGATAGAGAAGATAATATCGAACGGAGGGGAGGAGTTTTTGGGGAGGGCGATAGAGGAGCACGGGCGGGGGAAGGTGGCGGAGACGGTGGTGGAGATACAGGACCGGCACGGGGCGGCGAAGGAGATAGAGAGGAGCTTGCTAGAGCTGCACCAGGTGTTCTTGGACATGGCAGTGATGGTGGAGGCACAAGGGGAGAAAATGGATGACATTGAGCACCATGTCTTGAATGCTTCACACTATGTTAGAGATGGGACTAAGGATTTGAAGAATGCTAAGGATTTGCAAAGGAGTAGTAGGAAATGGATGTGTTTGGGGATTTTGCTTTTGCTGCTTATTGTTTTGGTTGTTGTTCTTCCAATTGTGGTTAGTTTTGGGAGTTCTTGA 927 51.89 MNDLMTKSFTSYVDLKKAAMKDIDLEAGLEMASSATDNGDMGLFLEEAEKVKMEMGSIREILGKLQQANEETKSAHKPETLKSLRNTINVDIVTVLKKARSIRSQLEEMDRANAAKKRLSGSKEGTAIYRTRIAVTNGLRKKLKELMMEFQSLRQRMMTEYKETVGRRYFTVTGEQPEEEVIEKIISNGGEEFLGRAIEEHGRGKVAETVVEIQDRHGAAKEIERSLLELHQVFLDMAVMVEAQGEKMDDIEHHVLNASHYVRDGTKDLKNAKDLQRSSRKWMCLGILLLLLIVLVVVLPIVVSFGSS 308
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
1 38659474 38660494 - Lag0012210.1 Lac1g1718 595289

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Lac1g1718 308 Pfam Syntaxin 44 245 IPR006011 GO:0016020(InterPro)
Lac1g1718 308 FunFam Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group 38 168 - -
Lac1g1718 308 CDD SynN 41 197 IPR006011 GO:0016020(InterPro)
Lac1g1718 308 PANTHER SYNTAXIN 47 293 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0005886(PANTHER)|GO:0006886(PANTHER)|GO:0006887(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Lac1g1718 308 SUPERFAMILY t-snare proteins 40 265 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Lac1g1718 308 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 210 272 IPR000727 -
Lac1g1718 308 SMART SynN_4 36 162 IPR006011 GO:0016020(InterPro)
Lac1g1718 308 Gene3D - 205 305 - -
Lac1g1718 308 ProSitePatterns Syntaxin / epimorphin family signature. 216 256 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Lac1g1718 308 CDD SNARE_syntaxin1-like 209 270 - -
Lac1g1718 308 Gene3D - 36 165 - -
Lac1g1718 308 SMART tSNARE_6 205 272 IPR000727 -
Lac1g1718 308 FunFam Syntaxin 132 203 303 - -
Lac1g1718 308 Coils Coil 136 156 - -
Lac1g1718 308 Pfam SNARE domain 247 298 IPR000727 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lac1g1718 K08486 - - csv:101220775 523.857
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Lac1g1718 Lac-Chr1:38659474 Lac1g2321 Lac-Chr1:44563397 1.30E-59 dispersed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lac6g1229 . 64 344 SNARE and Associated Proteins AT3G24350 63.7 7.1e-81 298.5
Lac1g1718 . 1 308 SNARE and Associated Proteins AT1G08560 69.6 8.7e-104 374.4
Lac1g2924 . 1 305 SNARE and Associated Proteins AT2G18260 55.6 1.6e-86 317.0
Lac10g2747 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.8e-115 412.1
Lac1g2321 . 30 283 SNARE and Associated Proteins AT3G11820 72.4 7.0e-101 364.8
Lac10g0809 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 4.5e-92 335.5
Lac10g2747 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 9.3e-91 331.3
Lac1g2321 . 35 283 SNARE and Associated Proteins AT3G52400 65.1 3.4e-85 312.8
Lac10g0809 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 5.1e-81 298.9
Lac10g0809 . 1 299 SNARE and Associated Proteins AT4G03330 68.5 1.7e-107 386.7
Lac10g2747 . 1 279 SNARE and Associated Proteins AT4G03330 57.5 8.3e-83 304.7
Lac1g2321 . 1 288 SNARE and Associated Proteins AT4G03330 54.2 3.3e-79 292.7
Lac10g0809 . 1 303 SNARE and Associated Proteins AT1G61290 78.9 3.8e-128 455.3
Lac10g2747 . 1 279 SNARE and Associated Proteins AT1G61290 62.3 4.8e-91 332.0
Lac1g2321 . 1 288 SNARE and Associated Proteins AT1G61290 55.9 5.4e-82 302.0
Lac10g0809 . 1 303 SNARE and Associated Proteins AT1G11250 77.2 1.1e-124 443.7
Lac10g2747 . 1 279 SNARE and Associated Proteins AT1G11250 63.1 1.3e-93 340.5
Lac1g2321 . 1 288 SNARE and Associated Proteins AT1G11250 56.9 5.1e-85 312.0
Lac7g1748 . 3 342 SNARE and Associated Proteins AT3G03800 57.2 6.2e-94 341.7
Lac9g2066 . 34 255 SNARE and Associated Proteins AT3G03800 59.9 4.0e-69 259.2
Lac7g1748 . 3 259 SNARE and Associated Proteins AT5G08080 60.7 2.8e-72 269.2
Lac9g2066 . 6 206 SNARE and Associated Proteins AT5G08080 59.7 1.0e-53 207.6
Lac5g0200 . 1 256 SNARE and Associated Proteins AT5G16830 59.2 5.8e-75 278.5
Lac5g0200 . 1 256 SNARE and Associated Proteins AT5G46860 66.8 1.5e-80 297.0
Lac5g0200 . 1 256 SNARE and Associated Proteins AT4G17730 61.3 2.3e-73 273.1
Lac5g0200 . 65 256 SNARE and Associated Proteins AT1G32270 60.4 3.8e-52 203.0
Lac13g1100 . 1 334 SNARE and Associated Proteins AT5G05760 66.3 1.1e-112 404.1
Lac6g1229 . 64 344 SNARE and Associated Proteins AT3G24350 63.7 7.1e-81 298.5
Lac6g2561 . 1 294 SNARE and Associated Proteins AT5G26980 75.5 9.0e-112 401.0
Lac4g2493 . 1 312 SNARE and Associated Proteins AT5G26980 66.6 1.4e-101 367.1
Lac4g2493 . 1 311 SNARE and Associated Proteins AT4G02195 65.9 5.0e-102 368.6
Lac6g2561 . 1 294 SNARE and Associated Proteins AT4G02195 65.2 3.2e-93 339.3
Lac6g2561 . 1 294 SNARE and Associated Proteins AT3G05710 73.2 1.6e-111 400.2
Lac4g2493 . 1 312 SNARE and Associated Proteins AT3G05710 62.8 4.2e-96 349.0
Lac2g1436 . 97 329 SNARE and Associated Proteins AT1G16240 71.7 3.5e-89 325.5
Lac5g1038 . 4 188 SNARE and Associated Proteins AT1G16240 69.2 1.4e-66 250.4
Lac2g1436 . 78 329 SNARE and Associated Proteins AT1G79590 66.7 3.0e-89 325.9
Lac5g1038 . 2 188 SNARE and Associated Proteins AT1G79590 69.5 5.4e-70 261.9
Lac2g1404 . 92 282 SNARE and Associated Proteins AT1G28490 71.2 7.9e-66 247.7
Lac10g3026 . 1 261 SNARE and Associated Proteins AT3G09740 79.1 1.4e-110 396.7
Lac9g2572 . 1 263 SNARE and Associated Proteins AT3G09740 67.5 4.1e-94 342.0
Lac9g2572 . 1 263 SNARE and Associated Proteins AT3G45280 65.3 1.7e-87 320.1
Lac10g3026 . 1 261 SNARE and Associated Proteins AT3G45280 64.4 6.4e-87 318.2
Lac10g3026 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 1.6e-95 346.7
Lac9g2572 . 1 263 SNARE and Associated Proteins AT3G61450 60.2 2.2e-84 309.7
Lac8g2909 . 249 469 SNARE and Associated Proteins AT1G51740 68.5 4.2e-77 285.4
Lac6g0895 . 319 458 SNARE and Associated Proteins AT1G51740 63.1 9.2e-40 161.4
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0010730 0 1 0 0 0 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 1 1 1 2 1 1 32