Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Lac2g1436 ATGGAAATAAGGTATTCTCAATCAAATTTGCGCAGACCCGAATTCCGACGTCCCGGTTTCCGATTCCGATTGATCGACGAACGTTGGTCGCCGGCGGTGGCGGATTGGTACCGTCTTCCCTCTAACCTCTGTATCCCTCCATACAATTGCCCGTACCCCCGCCCGTTGAATTCTCTTCTTTTCCGAACGGGGTATTTTTCGATATGTTTGTTGGTTTGTTCTATGGTATCTGTTGATTTCGGGGTTCGATTCTCCATGGCGTTTACCTCAATTCTCTTTTTTCTGCCAATGGCGTATACTTTGGAATCATGGACGAAGGAATACAGTGAAGCTTTGAAACTCTCTGAAGATATCAATGCCATGATTTCTGAGAGAAATTCACTTGCCGCATCTGGGCCGGAAGCTCAACGTCATGGCTCGGCTATACGCAGGAAGATCACAATATTGGGTACCAGACTTGATACCTTGCAGACTCAGTTGCCCAAGCTTCAAGGAAAGCAACCAATACCAGAGAAAGAGATGAATCGCCGCAGGGATATGATTGCAAATTTGAGATCAAAAGCTAACCAGATGGCTTCAGCTTTGAACATGTCAAACTTTGCGAACCGTGATAGCTTACTTGGTCCAGAAATAAAGCCAGCTGATGTTATGAACAGAACAGCAGGCTTGGACAACCAAGGCCTAGTTGGTTTTCAACGACAAATTATGAGAGAGCAAGATGAAGGACTCGAGAAACTGGAAGGGACTATAATTAGCACAAAACATATTGCATTGGCTGTGAACGAAGAACTTAACCTTCACACGAGACTCATTGATGATTTGGATGAACATGTCGATGTTACTGATTCACGATTACGGCGAGTGCAGAAGAGGCTGGCAATATTGAACAAGCGGACCAAGGGTGGTTGCACTTGCATGTCTATGATTTTATCAGTTGTTGGGATTGTCGTTCTTATCGCTGTCATATGGCTACTCATCAAGTATTTGTAA 990 44.55 MEIRYSQSNLRRPEFRRPGFRFRLIDERWSPAVADWYRLPSNLCIPPYNCPYPRPLNSLLFRTGYFSICLLVCSMVSVDFGVRFSMAFTSILFFLPMAYTLESWTKEYSEALKLSEDINAMISERNSLAASGPEAQRHGSAIRRKITILGTRLDTLQTQLPKLQGKQPIPEKEMNRRRDMIANLRSKANQMASALNMSNFANRDSLLGPEIKPADVMNRTAGLDNQGLVGFQRQIMREQDEGLEKLEGTIISTKHIALAVNEELNLHTRLIDDLDEHVDVTDSRLRRVQKRLAILNKRTKGGCTCMSMILSVVGIVVLIAVIWLLIKYL 329
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
2 12263020 12266866 + Lag0038074.1 Lac2g1436 598700

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Lac2g1436 329 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 233 295 IPR000727 -
Lac2g1436 329 FunFam syntaxin-51 isoform X2 235 297 - -
Lac2g1436 329 SUPERFAMILY SNARE fusion complex 224 295 - -
Lac2g1436 329 SMART tSNARE_6 228 295 IPR000727 -
Lac2g1436 329 Pfam SNARE domain 270 320 IPR000727 -
Lac2g1436 329 Gene3D - 235 297 - -
Lac2g1436 329 CDD SNARE_Qc 236 293 - -
Lac2g1436 329 PANTHER SYNTAXIN 106 315 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0006886(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lac2g1436 K08503 - - csv:101208669 407.142
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Lac2g1436 Lac-Chr2:12263020 Lac5g1038 Lac-Chr5:16893392 2.00E-74 dispersed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lac6g1229 . 64 344 SNARE and Associated Proteins AT3G24350 63.7 7.1e-81 298.5
Lac1g1718 . 1 308 SNARE and Associated Proteins AT1G08560 69.6 8.7e-104 374.4
Lac1g2924 . 1 305 SNARE and Associated Proteins AT2G18260 55.6 1.6e-86 317.0
Lac10g2747 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.8e-115 412.1
Lac1g2321 . 30 283 SNARE and Associated Proteins AT3G11820 72.4 7.0e-101 364.8
Lac10g0809 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 4.5e-92 335.5
Lac10g2747 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 9.3e-91 331.3
Lac1g2321 . 35 283 SNARE and Associated Proteins AT3G52400 65.1 3.4e-85 312.8
Lac10g0809 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 5.1e-81 298.9
Lac10g0809 . 1 299 SNARE and Associated Proteins AT4G03330 68.5 1.7e-107 386.7
Lac10g2747 . 1 279 SNARE and Associated Proteins AT4G03330 57.5 8.3e-83 304.7
Lac1g2321 . 1 288 SNARE and Associated Proteins AT4G03330 54.2 3.3e-79 292.7
Lac10g0809 . 1 303 SNARE and Associated Proteins AT1G61290 78.9 3.8e-128 455.3
Lac10g2747 . 1 279 SNARE and Associated Proteins AT1G61290 62.3 4.8e-91 332.0
Lac1g2321 . 1 288 SNARE and Associated Proteins AT1G61290 55.9 5.4e-82 302.0
Lac10g0809 . 1 303 SNARE and Associated Proteins AT1G11250 77.2 1.1e-124 443.7
Lac10g2747 . 1 279 SNARE and Associated Proteins AT1G11250 63.1 1.3e-93 340.5
Lac1g2321 . 1 288 SNARE and Associated Proteins AT1G11250 56.9 5.1e-85 312.0
Lac7g1748 . 3 342 SNARE and Associated Proteins AT3G03800 57.2 6.2e-94 341.7
Lac9g2066 . 34 255 SNARE and Associated Proteins AT3G03800 59.9 4.0e-69 259.2
Lac7g1748 . 3 259 SNARE and Associated Proteins AT5G08080 60.7 2.8e-72 269.2
Lac9g2066 . 6 206 SNARE and Associated Proteins AT5G08080 59.7 1.0e-53 207.6
Lac5g0200 . 1 256 SNARE and Associated Proteins AT5G16830 59.2 5.8e-75 278.5
Lac5g0200 . 1 256 SNARE and Associated Proteins AT5G46860 66.8 1.5e-80 297.0
Lac5g0200 . 1 256 SNARE and Associated Proteins AT4G17730 61.3 2.3e-73 273.1
Lac5g0200 . 65 256 SNARE and Associated Proteins AT1G32270 60.4 3.8e-52 203.0
Lac13g1100 . 1 334 SNARE and Associated Proteins AT5G05760 66.3 1.1e-112 404.1
Lac6g1229 . 64 344 SNARE and Associated Proteins AT3G24350 63.7 7.1e-81 298.5
Lac6g2561 . 1 294 SNARE and Associated Proteins AT5G26980 75.5 9.0e-112 401.0
Lac4g2493 . 1 312 SNARE and Associated Proteins AT5G26980 66.6 1.4e-101 367.1
Lac4g2493 . 1 311 SNARE and Associated Proteins AT4G02195 65.9 5.0e-102 368.6
Lac6g2561 . 1 294 SNARE and Associated Proteins AT4G02195 65.2 3.2e-93 339.3
Lac6g2561 . 1 294 SNARE and Associated Proteins AT3G05710 73.2 1.6e-111 400.2
Lac4g2493 . 1 312 SNARE and Associated Proteins AT3G05710 62.8 4.2e-96 349.0
Lac2g1436 . 97 329 SNARE and Associated Proteins AT1G16240 71.7 3.5e-89 325.5
Lac5g1038 . 4 188 SNARE and Associated Proteins AT1G16240 69.2 1.4e-66 250.4
Lac2g1436 . 78 329 SNARE and Associated Proteins AT1G79590 66.7 3.0e-89 325.9
Lac5g1038 . 2 188 SNARE and Associated Proteins AT1G79590 69.5 5.4e-70 261.9
Lac2g1404 . 92 282 SNARE and Associated Proteins AT1G28490 71.2 7.9e-66 247.7
Lac10g3026 . 1 261 SNARE and Associated Proteins AT3G09740 79.1 1.4e-110 396.7
Lac9g2572 . 1 263 SNARE and Associated Proteins AT3G09740 67.5 4.1e-94 342.0
Lac9g2572 . 1 263 SNARE and Associated Proteins AT3G45280 65.3 1.7e-87 320.1
Lac10g3026 . 1 261 SNARE and Associated Proteins AT3G45280 64.4 6.4e-87 318.2
Lac10g3026 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 1.6e-95 346.7
Lac9g2572 . 1 263 SNARE and Associated Proteins AT3G61450 60.2 2.2e-84 309.7
Lac8g2909 . 249 469 SNARE and Associated Proteins AT1G51740 68.5 4.2e-77 285.4
Lac6g0895 . 319 458 SNARE and Associated Proteins AT1G51740 63.1 9.2e-40 161.4
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002063 3 5 2 3 2 1 3 1 2 1 1 1 3 2 2 3 1 4 3 1 2 2 1 2 2 2 1 5 3 1 65