Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Lac5g1661 ATGTCAATGGCCGCCACCTCCACCACCCTCCTCCGGCCGACCCCCTTTCTCGGCCAGACCAAAGGCGCCTCTTCCCAGAACCCCCTCAGAGATGTCGTCGCCATGGGAACTGGAAAATACACCATGGGAAATGATCTGTGGTATGGACCAGACCGAGTGAAGTACTTGGGCCCCTTTTCAGCTCAGACTCCCTCCTACTTGAACGGCGAGTTCCCCGGCGATTATGGATGGGACACTGCCGGCTTGTCCGCCGATCCCGAGGCCTTCGCCAAGAACAGAGCCCTTGAGGTGATCCACGGGAGGTGGGCCATGTTGGGAGCCTTGGGGTGCATAACACCAGAGGTGCTGGCGAAATGGTTGAGAGTGGACTTCAAGGAGCCGGTCTGGTTCAAGGCCGGCGCCCAAATCTTCTCAGAAGGAGGGCTCGACTACCTGGGGAACCCGAACCTGGTCCACGCCCAGAGCATCCTGGCCGTGTTGGGCTTCCAAGTGGTCCTTATGGGCTTGGTCGAAGGCTTCCGCATCAACGGCCTGGACGGCGTCGGCGAGGGCAACGACCTGTACCCGGGCGGCCAGTACTTCGACCCACTCGGACTGGCCGACGACCCAGTCACCTTCGCCGAGCTCAAGGTCAAGGAGATCAAGAACGGCCGCCTCGCCATGTTCTCCATGTTCGGGTTCTTCGTTCAGGCCATCGTCACCGGGAAAGGCCCGCTCGAGAACCTTCTCGACCATCTCGACAACCCTGTCGCCAACAATGCTTGGGTTTATGCCACCAAGTTTGCTCCCGGCTCATAG 798 60.28 MSMAATSTTLLRPTPFLGQTKGASSQNPLRDVVAMGTGKYTMGNDLWYGPDRVKYLGPFSAQTPSYLNGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGALGCITPEVLAKWLRVDFKEPVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAVLGFQVVLMGLVEGFRINGLDGVGEGNDLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFAPGS 265
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
5 33724674 33725645 + Lag0018745.1 Lac5g1661 608303

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Lac5g1661 265 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 30 264 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0009941(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Lac5g1661 265 FunFam Chlorophyll a-b binding protein, chloroplastic 54 258 - -
Lac5g1661 265 Gene3D Chlorophyll a/b binding protein domain 54 258 - -
Lac5g1661 265 Pfam Chlorophyll A-B binding protein 64 232 IPR022796 -
Lac5g1661 265 SUPERFAMILY Chlorophyll a-b binding protein 46 262 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lac5g1661 K08914 - - vvi:100260599 513.457
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Lac5g1661 Lac-Chr5:33724674 Lac6g0319 Lac-Chr6:2619212 1.60E-26 dispersed
Lac10g1066 Lac-Chr10:8639904 Lac5g1661 Lac-Chr5:33724674 8.20E-95 transposed
Lac11g0445 Lac-Chr11:4584187 Lac5g1661 Lac-Chr5:33724674 2.80E-95 transposed
Lac12g0377 Lac-Chr12:4349059 Lac5g1661 Lac-Chr5:33724674 1.50E-101 transposed
Lac1g3495 Lac-Chr1:54257968 Lac5g1661 Lac-Chr5:33724674 2.80E-95 transposed
Lac2g0020 Lac-Chr2:209409 Lac5g1661 Lac-Chr5:33724674 6.00E-55 transposed
Lac9g2258 Lac-Chr9:41942147 Lac5g1661 Lac-Chr5:33724674 2.20E-95 transposed
Lac2g2682 Lac-Chr2:41283517 Lac5g1661 Lac-Chr5:33724674 3.70E-52 wgd
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lac7g2695 . 1 387 Chloroplast and Mitochondria Gene Families AT2G28800 66.3 5.4e-136 481.9
Lac6g0708 . 71 426 Chloroplast and Mitochondria Gene Families AT2G28800 55.2 2.8e-100 363.2
Lac6g0701 . 74 320 Chloroplast and Mitochondria Gene Families AT2G28800 51.4 4.4e-61 233.0
Lac8g1690 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 80.8 8.8e-118 420.6
Lac12g0377 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 89.8 2.2e-144 509.2
Lac9g2258 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 78.0 9.8e-121 430.6
Lac1g3495 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 2.2e-120 429.5
Lac10g1066 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.4 2.4e-119 426.0
Lac11g0445 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.2 3.2e-119 425.6
Lac5g1661 . 5 265 Chloroplast and Mitochondria Gene Families AT3G27690 67.4 5.2e-98 355.1
Lac2g2682 . 112 315 Chloroplast and Mitochondria Gene Families AT3G27690 51.7 9.7e-52 201.4
Lac13g0050 . 70 305 Chloroplast and Mitochondria Gene Families AT3G61470 85.7 1.4e-123 439.9
Lac3g0610 . 22 249 Chloroplast and Mitochondria Gene Families AT3G61470 51.7 8.6e-65 244.6
Lac10g0087 . 22 245 Chloroplast and Mitochondria Gene Families AT3G61470 51.1 1.4e-62 237.3
Lac6g0319 . 46 256 Chloroplast and Mitochondria Gene Families AT3G61470 50.9 2.4e-54 209.9
Lac8g2422 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 82.1 4.9e-90 328.2
Lac1g1888 . 59 346 Chloroplast and Mitochondria Gene Families AT3G08940 82.7 2.7e-136 482.3
Lac10g3209 . 112 359 Chloroplast and Mitochondria Gene Families AT3G08940 85.5 1.7e-122 436.4
Lac2g0020 . 26 250 Chloroplast and Mitochondria Gene Families AT1G76570 80.9 6.1e-116 414.8
Lac3g1509 . 1 273 Chloroplast and Mitochondria Gene Families AT1G61520 85.7 6.4e-135 477.6
Lac12g0377 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.8 3.3e-144 508.4
Lac9g2258 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 79.3 5.7e-120 427.9
Lac1g3495 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 7.4e-120 427.6
Lac10g1066 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 1.3e-119 426.8
Lac11g0445 . 27 265 Chloroplast and Mitochondria Gene Families AT2G05070 83.7 1.2e-117 420.2
Lac5g1661 . 8 265 Chloroplast and Mitochondria Gene Families AT2G05070 68.0 1.2e-98 357.1
Lac2g2682 . 112 315 Chloroplast and Mitochondria Gene Families AT2G05070 52.2 6.6e-52 201.8
Lac12g0377 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.9 1.8e-125 446.4
Lac9g2258 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 77.8 4.1e-101 365.5
Lac1g3495 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.9 5.4e-101 365.2
Lac10g1066 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.4 5.4e-101 365.2
Lac11g0445 . 8 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.6 1.0e-99 360.9
Lac5g1661 . 8 237 Chloroplast and Mitochondria Gene Families AT2G05100 67.6 3.0e-83 306.2
Lac2g2682 . 112 299 Chloroplast and Mitochondria Gene Families AT2G05100 50.8 2.3e-43 173.7
Lac1g1888 . 61 228 Chloroplast and Mitochondria Gene Families AT2G40100 73.8 1.6e-68 256.5
Lac10g3209 . 94 244 Chloroplast and Mitochondria Gene Families AT2G40100 63.5 5.1e-51 198.4
Lac9g2258 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 89.2 5.1e-137 484.6
Lac1g3495 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 89.1 3.3e-136 481.9
Lac10g1066 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.0 5.7e-136 481.1
Lac11g0445 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29930 85.3 3.1e-126 448.7
Lac12g0377 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29930 78.3 3.8e-116 415.2
Lac5g1661 . 35 265 Chloroplast and Mitochondria Gene Families AT1G29930 70.2 1.4e-94 343.6
Lac9g2258 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 89.2 8.8e-137 483.8
Lac1g3495 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.8 1.3e-135 479.9
Lac10g1066 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.6 2.2e-135 479.2
Lac11g0445 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29920 85.3 4.1e-126 448.4
Lac12g0377 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29920 77.9 2.2e-116 416.0
Lac5g1661 . 35 265 Chloroplast and Mitochondria Gene Families AT1G29920 70.2 1.4e-94 343.6
Lac9g2258 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 89.2 8.8e-137 483.8
Lac1g3495 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.8 1.3e-135 479.9
Lac10g1066 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.6 2.2e-135 479.2
Lac11g0445 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29910 85.3 4.1e-126 448.4
Lac12g0377 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29910 77.9 2.2e-116 416.0
Lac5g1661 . 35 265 Chloroplast and Mitochondria Gene Families AT1G29910 70.2 1.4e-94 343.6
Lac2g2682 . 50 330 Chloroplast and Mitochondria Gene Families AT4G10340 84.7 8.3e-138 487.3
Lac10g1066 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 7.2e-57 218.4
Lac1g3495 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 1.2e-56 217.6
Lac9g2258 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.6e-56 217.2
Lac11g0445 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.6e-56 217.2
Lac12g0377 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 4.4e-54 209.1
Lac5g1661 . 47 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 7.0e-52 201.8
Lac9g2258 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 89.2 3.3e-136 481.9
Lac10g1066 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 1.1e-134 476.9
Lac1g3495 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 1.4e-134 476.5
Lac11g0445 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34420 85.7 6.3e-127 451.1
Lac12g0377 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 77.2 7.7e-117 417.5
Lac5g1661 . 35 265 Chloroplast and Mitochondria Gene Families AT2G34420 70.7 1.4e-94 343.6
Lac1g3495 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 89.9 1.9e-136 482.6
Lac10g1066 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 2.5e-136 482.3
Lac9g2258 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 88.1 9.7e-136 480.3
Lac11g0445 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34430 86.0 8.8e-129 457.2
Lac12g0377 . 31 265 Chloroplast and Mitochondria Gene Families AT2G34430 83.2 2.1e-114 409.5
Lac5g1661 . 35 265 Chloroplast and Mitochondria Gene Families AT2G34430 71.4 1.4e-94 343.6
Lac1g1888 . 60 346 Chloroplast and Mitochondria Gene Families AT5G01530 82.6 5.0e-138 488.0
Lac10g3209 . 128 359 Chloroplast and Mitochondria Gene Families AT5G01530 91.8 1.7e-125 446.4
Lac5g1846 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.8 9.4e-144 506.9
Lac5g1846 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 85.8 7.9e-150 527.3
Lac9g2357 . 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 76.2 1.4e-144 510.0
Lac1g1832 . 9 310 Chloroplast and Mitochondria Gene Families AT2G30160 68.4 2.1e-116 416.4
Lac9g2357 . 5 327 Chloroplast and Mitochondria Gene Families AT1G07030 76.4 2.2e-142 502.7
Lac1g1832 . 5 310 Chloroplast and Mitochondria Gene Families AT1G07030 71.1 1.1e-122 437.2
Lac4g2489 . 1 305 Chloroplast and Mitochondria Gene Families AT2G47490 76.4 5.3e-133 471.5
Lac8g1479 . 11 311 Chloroplast and Mitochondria Gene Families AT2G47490 62.5 5.9e-108 388.3
Lac8g1479 . 10 361 Chloroplast and Mitochondria Gene Families AT1G25380 65.1 7.2e-126 448.0
Lac4g2489 . 11 297 Chloroplast and Mitochondria Gene Families AT1G25380 63.8 4.6e-104 375.6
Lac10g0805 . 5 583 Chloroplast and Mitochondria Gene Families AT4G21490 74.5 1.1e-256 883.2
Lac9g2123 . 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 69.3 2.7e-239 825.5
Lac12g0676 . 4 574 Chloroplast and Mitochondria Gene Families AT4G21490 64.2 6.6e-222 767.7
Lac4g2996 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 64.9 6.4e-62 234.6
Lac3g2041 . 4 179 Chloroplast and Mitochondria Gene Families AT1G17530 59.0 1.3e-51 200.3
Lac3g2041 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 58.4 5.2e-51 198.4
Lac4g2996 . 22 186 Chloroplast and Mitochondria Gene Families AT3G04800 54.5 2.2e-41 166.4
Lac4g2996 . 15 186 Chloroplast and Mitochondria Gene Families AT1G72750 68.9 6.5e-62 234.6
Lac3g2041 . 5 183 Chloroplast and Mitochondria Gene Families AT1G72750 58.8 5.5e-53 204.9
Lac13g0449 . 80 275 Chloroplast and Mitochondria Gene Families AT1G26100 64.3 8.2e-70 261.2
Lac8g2802 . 46 271 Chloroplast and Mitochondria Gene Families AT5G38630 70.5 5.3e-90 328.2
Lac11g0019 . 23 218 Chloroplast and Mitochondria Gene Families AT4G25570 69.4 6.1e-80 295.0
Lac3g0033 . 24 339 Chloroplast and Mitochondria Gene Families AT5G14040 83.3 2.9e-154 542.3
Lac8g2062 . 9 351 Chloroplast and Mitochondria Gene Families AT5G14040 75.0 1.8e-151 533.1
Lac8g0058 . 9 369 Chloroplast and Mitochondria Gene Families AT5G14040 66.9 1.3e-130 463.8
Lac12g0462 . 11 298 Chloroplast and Mitochondria Gene Families AT5G14040 51.7 2.4e-84 310.1
Lac3g0033 . 6 339 Chloroplast and Mitochondria Gene Families AT3G48850 68.9 4.0e-140 495.4
Lac8g2062 . 8 340 Chloroplast and Mitochondria Gene Families AT3G48850 67.3 7.0e-129 458.0
Lac8g0058 . 6 369 Chloroplast and Mitochondria Gene Families AT3G48850 61.5 9.5e-118 421.0
Lac12g0462 . 11 299 Chloroplast and Mitochondria Gene Families AT3G48850 50.9 2.4e-84 310.1
Lac12g0462 . 8 308 Chloroplast and Mitochondria Gene Families AT2G17270 74.5 1.3e-131 466.8
Lac3g0033 . 43 341 Chloroplast and Mitochondria Gene Families AT2G17270 50.7 2.4e-85 313.2
Lac8g2759 . 16 312 Chloroplast and Mitochondria Gene Families AT5G15640 77.3 1.8e-128 456.4
Lac2g0482 . 12 345 Chloroplast and Mitochondria Gene Families AT5G26200 67.7 5.8e-125 444.9
Lac4g3001 . 1 341 Chloroplast and Mitochondria Gene Families AT5G26200 58.1 3.9e-105 379.0
Lac4g3001 . 1 345 Chloroplast and Mitochondria Gene Families AT1G72820 76.8 7.6e-149 524.2
Lac2g0482 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 68.2 1.5e-128 456.8
Lac11g2058 . 91 296 Chloroplast and Mitochondria Gene Families AT5G52570 52.9 2.5e-50 196.4
Lac5g2972 . 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 63.3 3.9e-69 258.8
Lac11g2058 . 28 213 Chloroplast and Mitochondria Gene Families AT4G25700 61.7 3.6e-59 225.7
Lac5g1674 . 52 358 Chloroplast and Mitochondria Gene Families AT5G54290 74.8 4.4e-120 428.7
Lac3g0269 . 53 542 Chloroplast and Mitochondria Gene Families AT2G18710 85.0 3.4e-236 815.1
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0006810 2 1 0 2 1 1 0 1 1 1 1 1 2 1 1 2 0 2 2 1 1 2 2 1 1 1 1 1 1 1 35