Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Lac6g0895 ATGAGACGAGAGAAGAATGAGAGCGCTCAAAACAGCGAGGGGAAATCTCTCAAAGGGGTGATGTTCTTCACTGCATCTTCCGGCGAAAATGAGGTTAGATTTTCAGAGAAGCTTCAGAAACCCAAAAAATCTCTCCCTGGTTTGCAGTCCTCGGCAAGTTCCCGCGCACTCCGACTGCTTTTGTGTTGCGGGCGGTTCGTTTCCAATAGGTCCCCAGGAAAATTTTTGAGCTATATCATTCAGTGGAAGACAATGGATTCGATAGCAGAAGAGAAAACAACAATAAATTGGGAATCAAAATTGGGATTAAGAGATGAACTTGCTGCCGAGACGCTTTCTTCTGAGCCTCATTCTCACGTAATTTCTCCTATGTTCATCGCCCCACTAAGCAGCGTCGACGCCTTTAGCGAGAATCACTGCCGGAGGGTGTTGAAAAGGGCATTTGGATCGCTAAGAGGGGATTTTGGTGGCGATGAAGAACTGAGAAGCGAGCGGCAGAGCGGTGGTGGGGCAGAGGAGAATGTGGTTGAGCATTCGAAGAGAGGCTCCGACGGCGACGGGAGGAGGCTCAAGCGAGTGGGAAGAAGAAGAGAGAAGGTGAGGGAGAGAGGAGGGTTTCGGCTCGGAGGAGAAACAGGGGAGATTGACGTCACAGTCCCCACACGGACCGTCACCAACGCCTTTTTCTTTTGGTCTCATTTCCTTCCTTGTGTTTCCCATCACGCCGCTGATTCAACATCAAAACCATCCAACGGCTCATATCGTCCAACACGAGACTCAACGCTCAAAACCCAATCGCAGCCGTCCACAACACCCAAGATTCTCCACTACACTCCATCCGACGGTCACCACACGAACTACAGTGTATTAGGAAGCGGTTATAGAGCTCCGGCCATGGAGAAGGAGAGGGAGCAGCTTGTTTACTTGGCCAGACTTGCCGAACAAGCAGAGAGATACGACGTAACATCACAATTTGATAAGCTAAGGGCCATTCGGTTTCAAGATATCATAAACAAAGCAGTACCAAGAAGAAAACCAAACCAAGTTAATAAACCACGTTCTGCAAATGCCCCTGAATATAATAATACGGAGCTGAGGGAACCTGATAATTTTGAGCATCAACCTGTCCGAGCCCAACAGCAACTGTTGGATGACGAAACTCGTGCACTTCAGGTTGAATTGACTAGTCTACTTGACGCAGTACAGGAAACAGAAACTAAGATGGTAGAGATGTCTGCTTTGAATCACCTAATGTCTACGCACGTTTTGCAGCAAGCACAACAAATTGAACTTCTTTATGAACAGGCTATTGAAGCTACGAAGAATGTTGAGCTCGGAGTGAACTCATTTGCTACTTCAATTTCTCAAAGTGCCCTGCATTCATTTGTAGCTGCTGAAGCATGA 1404 47.58 MRREKNESAQNSEGKSLKGVMFFTASSGENEVRFSEKLQKPKKSLPGLQSSASSRALRLLLCCGRFVSNRSPGKFLSYIIQWKTMDSIAEEKTTINWESKLGLRDELAAETLSSEPHSHVISPMFIAPLSSVDAFSENHCRRVLKRAFGSLRGDFGGDEELRSERQSGGGAEENVVEHSKRGSDGDGRRLKRVGRRREKVRERGGFRLGGETGEIDVTVPTRTVTNAFFFWSHFLPCVSHHAADSTSKPSNGSYRPTRDSTLKTQSQPSTTPKILHYTPSDGHHTNYSVLGSGYRAPAMEKEREQLVYLARLAEQAERYDVTSQFDKLRAIRFQDIINKAVPRRKPNQVNKPRSANAPEYNNTELREPDNFEHQPVRAQQQLLDDETRALQVELTSLLDAVQETETKMVEMSALNHLMSTHVLQQAQQIELLYEQAIEATKNVELGVNSFATSISQSALHSFVAAEA 467
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
6 7895180 7899769 - Lag0004864.1 Lac6g0895 610664

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Lac6g0895 467 MobiDBLite consensus disorder prediction 243 282 - -
Lac6g0895 467 MobiDBLite consensus disorder prediction 349 363 - -
Lac6g0895 467 PANTHER SYNTAXIN-18 320 455 - GO:0005783(PANTHER)|GO:0006890(PANTHER)|GO:0031201(PANTHER)
Lac6g0895 467 MobiDBLite consensus disorder prediction 342 371 - -
Lac6g0895 467 MobiDBLite consensus disorder prediction 174 191 - -
Lac6g0895 467 MobiDBLite consensus disorder prediction 241 282 - -
Lac6g0895 467 MobiDBLite consensus disorder prediction 158 198 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lac6g0895 K08492 - - csv:101207161 232.646
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Lac4g2818 Lac-Chr4:46812422 Lac6g0895 Lac-Chr6:7895180 1.40E-57 dispersed
Lac6g0895 Lac-Chr6:7895180 Lac8g2909 Lac-Chr8:46209678 3.50E-72 dispersed
Lac6g0892 Lac-Chr6:7867681 Lac6g0895 Lac-Chr6:7895180 1.20E-130 proximal
Lac6g0893 Lac-Chr6:7872090 Lac6g0895 Lac-Chr6:7895180 1.20E-28 proximal
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lac6g1229 . 64 344 SNARE and Associated Proteins AT3G24350 63.7 7.1e-81 298.5
Lac1g1718 . 1 308 SNARE and Associated Proteins AT1G08560 69.6 8.7e-104 374.4
Lac1g2924 . 1 305 SNARE and Associated Proteins AT2G18260 55.6 1.6e-86 317.0
Lac10g2747 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.8e-115 412.1
Lac1g2321 . 30 283 SNARE and Associated Proteins AT3G11820 72.4 7.0e-101 364.8
Lac10g0809 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 4.5e-92 335.5
Lac10g2747 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 9.3e-91 331.3
Lac1g2321 . 35 283 SNARE and Associated Proteins AT3G52400 65.1 3.4e-85 312.8
Lac10g0809 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 5.1e-81 298.9
Lac10g0809 . 1 299 SNARE and Associated Proteins AT4G03330 68.5 1.7e-107 386.7
Lac10g2747 . 1 279 SNARE and Associated Proteins AT4G03330 57.5 8.3e-83 304.7
Lac1g2321 . 1 288 SNARE and Associated Proteins AT4G03330 54.2 3.3e-79 292.7
Lac10g0809 . 1 303 SNARE and Associated Proteins AT1G61290 78.9 3.8e-128 455.3
Lac10g2747 . 1 279 SNARE and Associated Proteins AT1G61290 62.3 4.8e-91 332.0
Lac1g2321 . 1 288 SNARE and Associated Proteins AT1G61290 55.9 5.4e-82 302.0
Lac10g0809 . 1 303 SNARE and Associated Proteins AT1G11250 77.2 1.1e-124 443.7
Lac10g2747 . 1 279 SNARE and Associated Proteins AT1G11250 63.1 1.3e-93 340.5
Lac1g2321 . 1 288 SNARE and Associated Proteins AT1G11250 56.9 5.1e-85 312.0
Lac7g1748 . 3 342 SNARE and Associated Proteins AT3G03800 57.2 6.2e-94 341.7
Lac9g2066 . 34 255 SNARE and Associated Proteins AT3G03800 59.9 4.0e-69 259.2
Lac7g1748 . 3 259 SNARE and Associated Proteins AT5G08080 60.7 2.8e-72 269.2
Lac9g2066 . 6 206 SNARE and Associated Proteins AT5G08080 59.7 1.0e-53 207.6
Lac5g0200 . 1 256 SNARE and Associated Proteins AT5G16830 59.2 5.8e-75 278.5
Lac5g0200 . 1 256 SNARE and Associated Proteins AT5G46860 66.8 1.5e-80 297.0
Lac5g0200 . 1 256 SNARE and Associated Proteins AT4G17730 61.3 2.3e-73 273.1
Lac5g0200 . 65 256 SNARE and Associated Proteins AT1G32270 60.4 3.8e-52 203.0
Lac13g1100 . 1 334 SNARE and Associated Proteins AT5G05760 66.3 1.1e-112 404.1
Lac6g1229 . 64 344 SNARE and Associated Proteins AT3G24350 63.7 7.1e-81 298.5
Lac6g2561 . 1 294 SNARE and Associated Proteins AT5G26980 75.5 9.0e-112 401.0
Lac4g2493 . 1 312 SNARE and Associated Proteins AT5G26980 66.6 1.4e-101 367.1
Lac4g2493 . 1 311 SNARE and Associated Proteins AT4G02195 65.9 5.0e-102 368.6
Lac6g2561 . 1 294 SNARE and Associated Proteins AT4G02195 65.2 3.2e-93 339.3
Lac6g2561 . 1 294 SNARE and Associated Proteins AT3G05710 73.2 1.6e-111 400.2
Lac4g2493 . 1 312 SNARE and Associated Proteins AT3G05710 62.8 4.2e-96 349.0
Lac2g1436 . 97 329 SNARE and Associated Proteins AT1G16240 71.7 3.5e-89 325.5
Lac5g1038 . 4 188 SNARE and Associated Proteins AT1G16240 69.2 1.4e-66 250.4
Lac2g1436 . 78 329 SNARE and Associated Proteins AT1G79590 66.7 3.0e-89 325.9
Lac5g1038 . 2 188 SNARE and Associated Proteins AT1G79590 69.5 5.4e-70 261.9
Lac2g1404 . 92 282 SNARE and Associated Proteins AT1G28490 71.2 7.9e-66 247.7
Lac10g3026 . 1 261 SNARE and Associated Proteins AT3G09740 79.1 1.4e-110 396.7
Lac9g2572 . 1 263 SNARE and Associated Proteins AT3G09740 67.5 4.1e-94 342.0
Lac9g2572 . 1 263 SNARE and Associated Proteins AT3G45280 65.3 1.7e-87 320.1
Lac10g3026 . 1 261 SNARE and Associated Proteins AT3G45280 64.4 6.4e-87 318.2
Lac10g3026 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 1.6e-95 346.7
Lac9g2572 . 1 263 SNARE and Associated Proteins AT3G61450 60.2 2.2e-84 309.7
Lac8g2909 . 249 469 SNARE and Associated Proteins AT1G51740 68.5 4.2e-77 285.4
Lac6g0895 . 319 458 SNARE and Associated Proteins AT1G51740 63.1 9.2e-40 161.4
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0014609 0 0 0 0 0 1 0 1 1 0 0 1 1 0 0 0 1 0 0 1 0 0 0 2 0 0 0 0 0 0 9