Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Lac9g2572 ATGACCGTAATCGACATCATCTTCCGAGTCGATTCTATCTGCAAAAAATACGACAAGTATGATGTCGAGAAACAGCGTGAGCTCAATGCTTATGGCGACGATGTCTTTGCTCGCCTCTTCGCCGCCGTTGAGGCCGAAATCGACGCCGCTCTCCAGAAATCGGAGGCTGCCTCGACCGAGAAGAATAGGGCTGCTGCAGTTGCCATGAACGCCGAGGTTCGGCGGAAGAAGGCCCGATTGATGGATGAAGTGCCTAAGCTTCGTAAATTGGCTCACAAGAAGGTTAAAGGGGTTCCGAAAGAAGAGCTTGCGGTCAGAGATGATCTTGTTCTTGGGCTCGAGGAGAGGATCAAAGCGATTCCAGATGGGGGTACCTCCGCAGGCAAACAATCTGGAGGATGGGCCTCCTCCTCCTCATCGAACAACATCAAATTTGACTCAACATCAGATGGAAACTTTGAGAGCGAGTATTTCCAGCAGAGTGAAGAATCAAGTCAATTTCGACAGGAGTATGAAATGCGGAAGATGAAACAGGACCAAGGGCTCGATATCATATCTGAAGGGTTGGATATGCTGAAAAATCTGGCCCATGATATGAATGAGGAATTGGACAGGCAAGTTCCATTAATTGACGAGATCGACGCAAAGGTTGACAAGGTGACTAATGAGATTAAAAATACCAATGTTAGGCTCAAGGAAACACTCTATGAGGTGAGATCCAGTCAAAACTTCTGCATTGATATCATTCTTCTCTGTGTAATTCTTGGAATCGCTTCTTACTTATACAAGTAA 792 46.34 MTVIDIIFRVDSICKKYDKYDVEKQRELNAYGDDVFARLFAAVEAEIDAALQKSEAASTEKNRAAAVAMNAEVRRKKARLMDEVPKLRKLAHKKVKGVPKEELAVRDDLVLGLEERIKAIPDGGTSAGKQSGGWASSSSSNNIKFDSTSDGNFESEYFQQSEESSQFRQEYEMRKMKQDQGLDIISEGLDMLKNLAHDMNEELDRQVPLIDEIDAKVDKVTNEIKNTNVRLKETLYEVRSSQNFCIDIILLCVILGIASYLYK 263
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
9 44322461 44324074 + Lag0010059.1 Lac9g2572 621498

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Lac9g2572 263 Gene3D - 172 233 - -
Lac9g2572 263 MobiDBLite consensus disorder prediction 129 146 - -
Lac9g2572 263 ProSitePatterns Syntaxin / epimorphin family signature. 178 217 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Lac9g2572 263 SMART tSNARE_6 167 234 IPR000727 -
Lac9g2572 263 Pfam SNARE domain 209 258 IPR000727 -
Lac9g2572 263 SUPERFAMILY SNARE fusion complex 167 232 - -
Lac9g2572 263 Coils Coil 210 230 - -
Lac9g2572 263 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 172 234 IPR000727 -
Lac9g2572 263 MobiDBLite consensus disorder prediction 121 146 - -
Lac9g2572 263 PANTHER SYNTAXIN 7 252 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0006886(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Lac9g2572 263 FunFam Putative syntaxin-71-like 172 233 - -
Lac9g2572 263 CDD SNARE_Qc 177 233 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lac9g2572 K08506 - - csv:101211289 435.261
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Lac1g1934 Lac-Chr1:40992214 Lac9g2572 Lac-Chr9:44322461 2.70E-19 dispersed
Lac10g3026 Lac-Chr10:44824372 Lac9g2572 Lac-Chr9:44322461 1.40E-100 wgd
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lac6g1229 . 64 344 SNARE and Associated Proteins AT3G24350 63.7 7.1e-81 298.5
Lac1g1718 . 1 308 SNARE and Associated Proteins AT1G08560 69.6 8.7e-104 374.4
Lac1g2924 . 1 305 SNARE and Associated Proteins AT2G18260 55.6 1.6e-86 317.0
Lac10g2747 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.8e-115 412.1
Lac1g2321 . 30 283 SNARE and Associated Proteins AT3G11820 72.4 7.0e-101 364.8
Lac10g0809 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 4.5e-92 335.5
Lac10g2747 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 9.3e-91 331.3
Lac1g2321 . 35 283 SNARE and Associated Proteins AT3G52400 65.1 3.4e-85 312.8
Lac10g0809 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 5.1e-81 298.9
Lac10g0809 . 1 299 SNARE and Associated Proteins AT4G03330 68.5 1.7e-107 386.7
Lac10g2747 . 1 279 SNARE and Associated Proteins AT4G03330 57.5 8.3e-83 304.7
Lac1g2321 . 1 288 SNARE and Associated Proteins AT4G03330 54.2 3.3e-79 292.7
Lac10g0809 . 1 303 SNARE and Associated Proteins AT1G61290 78.9 3.8e-128 455.3
Lac10g2747 . 1 279 SNARE and Associated Proteins AT1G61290 62.3 4.8e-91 332.0
Lac1g2321 . 1 288 SNARE and Associated Proteins AT1G61290 55.9 5.4e-82 302.0
Lac10g0809 . 1 303 SNARE and Associated Proteins AT1G11250 77.2 1.1e-124 443.7
Lac10g2747 . 1 279 SNARE and Associated Proteins AT1G11250 63.1 1.3e-93 340.5
Lac1g2321 . 1 288 SNARE and Associated Proteins AT1G11250 56.9 5.1e-85 312.0
Lac7g1748 . 3 342 SNARE and Associated Proteins AT3G03800 57.2 6.2e-94 341.7
Lac9g2066 . 34 255 SNARE and Associated Proteins AT3G03800 59.9 4.0e-69 259.2
Lac7g1748 . 3 259 SNARE and Associated Proteins AT5G08080 60.7 2.8e-72 269.2
Lac9g2066 . 6 206 SNARE and Associated Proteins AT5G08080 59.7 1.0e-53 207.6
Lac5g0200 . 1 256 SNARE and Associated Proteins AT5G16830 59.2 5.8e-75 278.5
Lac5g0200 . 1 256 SNARE and Associated Proteins AT5G46860 66.8 1.5e-80 297.0
Lac5g0200 . 1 256 SNARE and Associated Proteins AT4G17730 61.3 2.3e-73 273.1
Lac5g0200 . 65 256 SNARE and Associated Proteins AT1G32270 60.4 3.8e-52 203.0
Lac13g1100 . 1 334 SNARE and Associated Proteins AT5G05760 66.3 1.1e-112 404.1
Lac6g1229 . 64 344 SNARE and Associated Proteins AT3G24350 63.7 7.1e-81 298.5
Lac6g2561 . 1 294 SNARE and Associated Proteins AT5G26980 75.5 9.0e-112 401.0
Lac4g2493 . 1 312 SNARE and Associated Proteins AT5G26980 66.6 1.4e-101 367.1
Lac4g2493 . 1 311 SNARE and Associated Proteins AT4G02195 65.9 5.0e-102 368.6
Lac6g2561 . 1 294 SNARE and Associated Proteins AT4G02195 65.2 3.2e-93 339.3
Lac6g2561 . 1 294 SNARE and Associated Proteins AT3G05710 73.2 1.6e-111 400.2
Lac4g2493 . 1 312 SNARE and Associated Proteins AT3G05710 62.8 4.2e-96 349.0
Lac2g1436 . 97 329 SNARE and Associated Proteins AT1G16240 71.7 3.5e-89 325.5
Lac5g1038 . 4 188 SNARE and Associated Proteins AT1G16240 69.2 1.4e-66 250.4
Lac2g1436 . 78 329 SNARE and Associated Proteins AT1G79590 66.7 3.0e-89 325.9
Lac5g1038 . 2 188 SNARE and Associated Proteins AT1G79590 69.5 5.4e-70 261.9
Lac2g1404 . 92 282 SNARE and Associated Proteins AT1G28490 71.2 7.9e-66 247.7
Lac10g3026 . 1 261 SNARE and Associated Proteins AT3G09740 79.1 1.4e-110 396.7
Lac9g2572 . 1 263 SNARE and Associated Proteins AT3G09740 67.5 4.1e-94 342.0
Lac9g2572 . 1 263 SNARE and Associated Proteins AT3G45280 65.3 1.7e-87 320.1
Lac10g3026 . 1 261 SNARE and Associated Proteins AT3G45280 64.4 6.4e-87 318.2
Lac10g3026 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 1.6e-95 346.7
Lac9g2572 . 1 263 SNARE and Associated Proteins AT3G61450 60.2 2.2e-84 309.7
Lac8g2909 . 249 469 SNARE and Associated Proteins AT1G51740 68.5 4.2e-77 285.4
Lac6g0895 . 319 458 SNARE and Associated Proteins AT1G51740 63.1 9.2e-40 161.4
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002038 1 2 1 1 1 2 3 2 2 2 2 2 3 3 2 3 2 2 3 2 3 2 2 2 2 2 3 2 2 2 63