Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Lcy10g0262 ATGTCGCAGCTTTCGTCCTCCGTTCTTCAACCTTCGGCCGCTGCAGGTATCATTCCTATCTTCTTCAACCTTCGGTCGCCGCAGCTGTCATTCTTCCCTTCTTCAACCTTTGGCCGTCGGAGCTCTCCTTCCCCTTGTCTTCAACCCACGACAGCGAACAAACCTCAGCGACGGCATCAAGGCGACGACTGGACAGAGACCAAAAGCATCCGACTTTTAACCGTTGAATTCCAAGAGGATATGAACATTAGAAAAAATGTCCAGCATTCTCTTGCTACAGAGCTTCAGAATCTTTCTATGGACCTTCGTAGAAGACGGTCAATGTATCTGAAACGTCTACAGCAGCAAAAGGAGGGACATGATGGAATTGATTTGGAGATAAATTTGAATGGCAACAAAACTCTACATGAGGATGATGAATATGGTGAATTTGTATGTGCTCATCTCTTTGGTTACCTTGACTTATCAAGACTTAACTTTTCTCATGCAAGGGGAACCATTGAAAACCAAACGATGACATTTGGAATTGATGAGCAGCACATCCAGGGAAGGGAGAAAGAGATCAGACAGGTTGTGAAATCAGTAAATGAGCTTGCACAAATTATGAAGGATCTCTCAACCCTTGTCATAGAGCAGGGTACTATAGTCGATAGGATCGACCACAATATTCAGAATGTTGCTACAACCGTGGAAGAGGGCTATAAACAGCTTCAGAAGGCGGAGAAGACTCAGAAGGATGGAGGAATGGTGAAGTGTGCAACAGTGCTTGTTATTATGTGTTTCATTTTGAGAACTGCTGGCGTCTCCTCGGCTTGGATTTAG 822 44.65 MSQLSSSVLQPSAAAGIIPIFFNLRSPQLSFFPSSTFGRRSSPSPCLQPTTANKPQRRHQGDDWTETKSIRLLTVEFQEDMNIRKNVQHSLATELQNLSMDLRRRRSMYLKRLQQQKEGHDGIDLEINLNGNKTLHEDDEYGEFVCAHLFGYLDLSRLNFSHARGTIENQTMTFGIDEQHIQGREKEIRQVVKSVNELAQIMKDLSTLVIEQGTIVDRIDHNIQNVATTVEEGYKQLQKAEKTQKDGGMVKCATVLVIMCFILRTAGVSSAWI 273
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
10 4233133 4235577 + Maker00001736 Lcy10g0262 643773

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Lcy10g0262 273 CDD SNARE_syntaxin16 181 239 - -
Lcy10g0262 273 MobiDBLite consensus disorder prediction 35 65 - -
Lcy10g0262 273 SUPERFAMILY t-snare proteins 80 233 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Lcy10g0262 273 PANTHER SYNTAXIN 76 258 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0006886(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Lcy10g0262 273 SMART tSNARE_6 173 240 IPR000727 -
Lcy10g0262 273 MobiDBLite consensus disorder prediction 35 55 - -
Lcy10g0262 273 ProSitePatterns Syntaxin / epimorphin family signature. 184 223 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Lcy10g0262 273 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 178 240 IPR000727 -
Lcy10g0262 273 Gene3D - 50 232 - -
Lcy10g0262 273 Pfam SNARE domain 214 263 IPR000727 -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lcy10g0262 K08489 - - csv:101204192 269.24
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Lcy10g0262 Lcy-Chr10:4233133 Lcy3g1779 Lcy-Chr3:45047568 3.54E-102 dispersed
Lcy10g0262 Lcy-Chr10:4233133 Lcy13g1039 Lcy-Chr13:22711472 1.83E-68 transposed
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lcy13g1316 . 8 286 SNARE and Associated Proteins AT3G24350 63.0 1.1e-80 297.7
Lcy1g1665 . 1 309 SNARE and Associated Proteins AT1G08560 69.7 4.7e-104 375.2
Lcy11g0712 . 106 296 SNARE and Associated Proteins AT1G08560 50.5 1.1e-44 177.9
Lcy1g0704 . 405 709 SNARE and Associated Proteins AT2G18260 55.6 6.7e-87 318.2
Lcy5g0507 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.5e-115 412.1
Lcy5g2615 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.5e-115 412.1
Lcy1g1206 . 23 281 SNARE and Associated Proteins AT3G11820 72.6 1.7e-101 366.7
Lcy5g1935 . 31 281 SNARE and Associated Proteins AT3G11820 66.9 6.5e-93 338.2
Lcy11g0712 . 91 296 SNARE and Associated Proteins AT3G11820 57.3 4.3e-60 229.2
Lcy5g0507 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 8.6e-91 331.3
Lcy5g2615 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 8.6e-91 331.3
Lcy1g1206 . 1 281 SNARE and Associated Proteins AT3G52400 60.1 4.9e-86 315.5
Lcy5g1935 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 2.1e-81 300.1
Lcy11g0712 . 88 296 SNARE and Associated Proteins AT3G52400 53.6 9.3e-53 204.9
Lcy5g1935 . 1 299 SNARE and Associated Proteins AT4G03330 69.2 2.4e-108 389.4
Lcy5g0507 . 1 279 SNARE and Associated Proteins AT4G03330 57.5 1.0e-82 304.3
Lcy5g2615 . 1 279 SNARE and Associated Proteins AT4G03330 57.5 1.0e-82 304.3
Lcy1g1206 . 1 287 SNARE and Associated Proteins AT4G03330 54.3 6.8e-79 291.6
Lcy11g0712 . 91 296 SNARE and Associated Proteins AT4G03330 59.2 2.4e-60 229.9
Lcy5g1935 . 1 303 SNARE and Associated Proteins AT1G61290 78.9 1.6e-128 456.4
Lcy5g0507 . 1 279 SNARE and Associated Proteins AT1G61290 62.3 5.9e-91 331.6
Lcy5g2615 . 1 279 SNARE and Associated Proteins AT1G61290 62.3 5.9e-91 331.6
Lcy1g1206 . 1 287 SNARE and Associated Proteins AT1G61290 56.4 5.9e-83 305.1
Lcy11g0712 . 88 296 SNARE and Associated Proteins AT1G61290 54.1 4.2e-57 219.2
Lcy5g1935 . 1 303 SNARE and Associated Proteins AT1G11250 77.9 1.6e-125 446.4
Lcy5g0507 . 1 279 SNARE and Associated Proteins AT1G11250 63.1 1.6e-93 340.1
Lcy5g2615 . 1 279 SNARE and Associated Proteins AT1G11250 63.1 1.6e-93 340.1
Lcy1g1206 . 1 287 SNARE and Associated Proteins AT1G11250 57.8 5.6e-86 315.1
Lcy11g0712 . 88 296 SNARE and Associated Proteins AT1G11250 55.5 2.0e-59 226.9
Lcy11g0712 . 90 320 SNARE and Associated Proteins AT3G03800 77.5 5.3e-92 335.1
Lcy11g0712 . 90 214 SNARE and Associated Proteins AT5G08080 82.4 2.3e-52 203.0
Lcy6g2242 . 5 158 SNARE and Associated Proteins AT5G16830 59.7 7.4e-40 161.8
Lcy6g2242 . 4 129 SNARE and Associated Proteins AT5G46860 80.2 1.3e-46 184.1
Lcy6g2242 . 4 129 SNARE and Associated Proteins AT4G17730 77.0 5.9e-47 185.3
Lcy6g2242 . 2 157 SNARE and Associated Proteins AT1G32270 60.9 2.5e-42 170.2
Lcy7g0975 . 1 334 SNARE and Associated Proteins AT5G05760 66.9 4.2e-114 408.7
Lcy13g1316 . 8 286 SNARE and Associated Proteins AT3G24350 63.0 1.1e-80 297.7
Lcy4g1808 . 1 311 SNARE and Associated Proteins AT5G26980 70.4 3.3e-116 415.6
Lcy3g1779 . 1 320 SNARE and Associated Proteins AT5G26980 67.1 2.2e-104 376.3
Lcy10g0262 . 79 263 SNARE and Associated Proteins AT5G26980 58.9 2.3e-45 180.3
Lcy3g1779 . 1 320 SNARE and Associated Proteins AT4G02195 66.3 2.2e-104 376.3
Lcy4g1808 . 1 314 SNARE and Associated Proteins AT4G02195 59.1 3.9e-93 339.0
Lcy10g0262 . 79 263 SNARE and Associated Proteins AT4G02195 58.3 6.5e-48 188.7
Lcy4g1808 . 1 312 SNARE and Associated Proteins AT3G05710 68.6 1.6e-113 406.8
Lcy3g1779 . 1 323 SNARE and Associated Proteins AT3G05710 63.7 5.8e-100 361.7
Lcy10g0262 . 71 263 SNARE and Associated Proteins AT3G05710 58.0 4.1e-45 179.5
Lcy9g1162 . 137 318 SNARE and Associated Proteins AT1G16240 70.5 5.9e-67 251.5
Lcy6g1648 . 12 188 SNARE and Associated Proteins AT1G16240 68.1 7.5e-62 234.6
Lcy9g1162 . 137 318 SNARE and Associated Proteins AT1G79590 68.9 5.1e-67 251.9
Lcy6g1648 . 6 188 SNARE and Associated Proteins AT1G79590 67.5 8.8e-67 251.1
Lcy9g1185 . 56 247 SNARE and Associated Proteins AT1G28490 71.9 2.5e-66 249.2
Lcy5g0279 . 44 304 SNARE and Associated Proteins AT3G09740 79.5 2.6e-111 399.1
Lcy1g2796 . 1 286 SNARE and Associated Proteins AT3G09740 61.8 4.4e-90 328.6
Lcy1g2792 . 1 286 SNARE and Associated Proteins AT3G09740 61.5 2.2e-89 326.2
Lcy8g1893 . 1 283 SNARE and Associated Proteins AT3G09740 58.6 2.0e-82 303.1
Lcy5g0279 . 44 307 SNARE and Associated Proteins AT3G45280 64.0 9.1e-88 320.9
Lcy1g2796 . 1 286 SNARE and Associated Proteins AT3G45280 59.7 3.0e-83 305.8
Lcy1g2792 . 1 286 SNARE and Associated Proteins AT3G45280 59.4 1.5e-82 303.5
Lcy8g1893 . 1 283 SNARE and Associated Proteins AT3G45280 56.5 1.8e-75 280.0
Lcy5g0279 . 44 304 SNARE and Associated Proteins AT3G61450 67.8 5.8e-95 344.7
Lcy1g2792 . 1 287 SNARE and Associated Proteins AT3G61450 55.9 3.6e-81 298.9
Lcy1g2796 . 1 287 SNARE and Associated Proteins AT3G61450 55.9 4.7e-81 298.5
Lcy8g1893 . 1 284 SNARE and Associated Proteins AT3G61450 53.7 1.1e-74 277.3
Lcy4g1484 . 48 260 SNARE and Associated Proteins AT1G51740 69.0 2.6e-81 299.3
Lcy10g2218 . 37 237 SNARE and Associated Proteins AT1G51740 70.3 5.5e-71 265.0
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0017151 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 3