Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Lcy1g1665 ATGAACGACTTGATGACCAAATCCTTCACCAGCTATGTGGATCTGAAGAAGGCCGCCATGAAAGACATCGACCTCGAAGCCGGTCTAGAAATGGCGTCGTCCGCTACCGACAACGGCGACATGGGTCTCTTCCTGGAAGAGGCTGAGAAGGTGAAAATGGAGATGGGTTCGATCAGAGAGATTCTGGGAAAGCTCCAGCAGGCCAATGAGGAGACTAAATCTGCTCACAAACCAGAAACTCTCAAATCGCTTCGAAATACGATTAATGTCGACATTGTCACGGTCCTGAAGAAGGCGCGGTCGATCCGATCCCAGCTCGAGGAAATGGACCGCGCCAATGCTGCCAAGAAGAGGCTCTCCGGCAGCAAAGAGGGCACTGCCATTTACAGGACCCGAATCGCGGTGACGAACGGGCTGCGAAAGAAGCTAAAGGAACTGATGATGGAGTTTCAGAGCCTAAGACAGAGGATGATGACGGAGTACAAGGAGACAGTAGGGCGACAATACTTCACGGTGACGGGAGAGCAACCGGAGGAGGAGGTGATAGAGAAGATAATATCGAACGGAGGGGAGGAGTTTTTGGGGAGGGCGATAGAGGAGCACGGGCGGGGGAAGGTGGCGGAGACGGTGGTGGAGATACAGGACCGGCACGGGGCGGCGAAGGAGATAGAGAGGAGCTTGCTGGAGCTGCACCAGGTGTTCTTGGACATGGCAGTGATGGTGGAGGCACAAGGGGAGAAAATGGATGACATTGAGCACCATGTCTTGAATGCTTCACACTATGTTAGAGATGGGACTAAGGATTTGAAGACTGCTAAGGATTTGCAAAGGAGTAGTAGGAAATGGATGTGTTTGGGGATTTTGCTTTTGCTGCTTATTGTTTTGGTTGTTGTTCTTCCAATTGTGGTTAGTTTTGGGAGTTCTTGA 927 51.46 MNDLMTKSFTSYVDLKKAAMKDIDLEAGLEMASSATDNGDMGLFLEEAEKVKMEMGSIREILGKLQQANEETKSAHKPETLKSLRNTINVDIVTVLKKARSIRSQLEEMDRANAAKKRLSGSKEGTAIYRTRIAVTNGLRKKLKELMMEFQSLRQRMMTEYKETVGRQYFTVTGEQPEEEVIEKIISNGGEEFLGRAIEEHGRGKVAETVVEIQDRHGAAKEIERSLLELHQVFLDMAVMVEAQGEKMDDIEHHVLNASHYVRDGTKDLKTAKDLQRSSRKWMCLGILLLLLIVLVVVLPIVVSFGSS 308
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
1 17190631 17191897 + Maker00012721 Lcy1g1665 623577

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Lcy1g1665 308 FunFam Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group 38 168 - -
Lcy1g1665 308 PANTHER SYNTAXIN 47 293 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0005886(PANTHER)|GO:0006886(PANTHER)|GO:0006887(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Lcy1g1665 308 SUPERFAMILY t-snare proteins 40 265 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Lcy1g1665 308 ProSitePatterns Syntaxin / epimorphin family signature. 216 256 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Lcy1g1665 308 Pfam SNARE domain 247 298 IPR000727 -
Lcy1g1665 308 CDD SNARE_syntaxin1-like 209 271 - -
Lcy1g1665 308 SMART tSNARE_6 205 272 IPR000727 -
Lcy1g1665 308 Pfam Syntaxin 44 245 IPR006011 GO:0016020(InterPro)
Lcy1g1665 308 CDD SynN 41 197 IPR006011 GO:0016020(InterPro)
Lcy1g1665 308 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 210 272 IPR000727 -
Lcy1g1665 308 SMART SynN_4 36 162 IPR006011 GO:0016020(InterPro)
Lcy1g1665 308 Gene3D - 205 305 - -
Lcy1g1665 308 Gene3D - 41 168 - -
Lcy1g1665 308 FunFam Syntaxin 132 203 303 - -
Lcy1g1665 308 Coils Coil 136 156 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lcy1g1665 K08486 - - csv:101220775 524.242
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Lcy1g0704 Lcy-Chr1:6032015 Lcy1g1665 Lcy-Chr1:17190631 4.41E-66 dispersed
Lcy1g1665 Lcy-Chr1:17190631 Lcy5g1935 Lcy-Chr5:42182030 5.24E-86 dispersed
Lcy1g1665 Lcy-Chr1:17190631 Lcy5g0507 Lcy-Chr5:5585492 8.24E-72 transposed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lcy13g1316 . 8 286 SNARE and Associated Proteins AT3G24350 63.0 1.1e-80 297.7
Lcy1g1665 . 1 309 SNARE and Associated Proteins AT1G08560 69.7 4.7e-104 375.2
Lcy11g0712 . 106 296 SNARE and Associated Proteins AT1G08560 50.5 1.1e-44 177.9
Lcy1g0704 . 405 709 SNARE and Associated Proteins AT2G18260 55.6 6.7e-87 318.2
Lcy5g0507 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.5e-115 412.1
Lcy5g2615 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.5e-115 412.1
Lcy1g1206 . 23 281 SNARE and Associated Proteins AT3G11820 72.6 1.7e-101 366.7
Lcy5g1935 . 31 281 SNARE and Associated Proteins AT3G11820 66.9 6.5e-93 338.2
Lcy11g0712 . 91 296 SNARE and Associated Proteins AT3G11820 57.3 4.3e-60 229.2
Lcy5g0507 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 8.6e-91 331.3
Lcy5g2615 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 8.6e-91 331.3
Lcy1g1206 . 1 281 SNARE and Associated Proteins AT3G52400 60.1 4.9e-86 315.5
Lcy5g1935 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 2.1e-81 300.1
Lcy11g0712 . 88 296 SNARE and Associated Proteins AT3G52400 53.6 9.3e-53 204.9
Lcy5g1935 . 1 299 SNARE and Associated Proteins AT4G03330 69.2 2.4e-108 389.4
Lcy5g0507 . 1 279 SNARE and Associated Proteins AT4G03330 57.5 1.0e-82 304.3
Lcy5g2615 . 1 279 SNARE and Associated Proteins AT4G03330 57.5 1.0e-82 304.3
Lcy1g1206 . 1 287 SNARE and Associated Proteins AT4G03330 54.3 6.8e-79 291.6
Lcy11g0712 . 91 296 SNARE and Associated Proteins AT4G03330 59.2 2.4e-60 229.9
Lcy5g1935 . 1 303 SNARE and Associated Proteins AT1G61290 78.9 1.6e-128 456.4
Lcy5g0507 . 1 279 SNARE and Associated Proteins AT1G61290 62.3 5.9e-91 331.6
Lcy5g2615 . 1 279 SNARE and Associated Proteins AT1G61290 62.3 5.9e-91 331.6
Lcy1g1206 . 1 287 SNARE and Associated Proteins AT1G61290 56.4 5.9e-83 305.1
Lcy11g0712 . 88 296 SNARE and Associated Proteins AT1G61290 54.1 4.2e-57 219.2
Lcy5g1935 . 1 303 SNARE and Associated Proteins AT1G11250 77.9 1.6e-125 446.4
Lcy5g0507 . 1 279 SNARE and Associated Proteins AT1G11250 63.1 1.6e-93 340.1
Lcy5g2615 . 1 279 SNARE and Associated Proteins AT1G11250 63.1 1.6e-93 340.1
Lcy1g1206 . 1 287 SNARE and Associated Proteins AT1G11250 57.8 5.6e-86 315.1
Lcy11g0712 . 88 296 SNARE and Associated Proteins AT1G11250 55.5 2.0e-59 226.9
Lcy11g0712 . 90 320 SNARE and Associated Proteins AT3G03800 77.5 5.3e-92 335.1
Lcy11g0712 . 90 214 SNARE and Associated Proteins AT5G08080 82.4 2.3e-52 203.0
Lcy6g2242 . 5 158 SNARE and Associated Proteins AT5G16830 59.7 7.4e-40 161.8
Lcy6g2242 . 4 129 SNARE and Associated Proteins AT5G46860 80.2 1.3e-46 184.1
Lcy6g2242 . 4 129 SNARE and Associated Proteins AT4G17730 77.0 5.9e-47 185.3
Lcy6g2242 . 2 157 SNARE and Associated Proteins AT1G32270 60.9 2.5e-42 170.2
Lcy7g0975 . 1 334 SNARE and Associated Proteins AT5G05760 66.9 4.2e-114 408.7
Lcy13g1316 . 8 286 SNARE and Associated Proteins AT3G24350 63.0 1.1e-80 297.7
Lcy4g1808 . 1 311 SNARE and Associated Proteins AT5G26980 70.4 3.3e-116 415.6
Lcy3g1779 . 1 320 SNARE and Associated Proteins AT5G26980 67.1 2.2e-104 376.3
Lcy10g0262 . 79 263 SNARE and Associated Proteins AT5G26980 58.9 2.3e-45 180.3
Lcy3g1779 . 1 320 SNARE and Associated Proteins AT4G02195 66.3 2.2e-104 376.3
Lcy4g1808 . 1 314 SNARE and Associated Proteins AT4G02195 59.1 3.9e-93 339.0
Lcy10g0262 . 79 263 SNARE and Associated Proteins AT4G02195 58.3 6.5e-48 188.7
Lcy4g1808 . 1 312 SNARE and Associated Proteins AT3G05710 68.6 1.6e-113 406.8
Lcy3g1779 . 1 323 SNARE and Associated Proteins AT3G05710 63.7 5.8e-100 361.7
Lcy10g0262 . 71 263 SNARE and Associated Proteins AT3G05710 58.0 4.1e-45 179.5
Lcy9g1162 . 137 318 SNARE and Associated Proteins AT1G16240 70.5 5.9e-67 251.5
Lcy6g1648 . 12 188 SNARE and Associated Proteins AT1G16240 68.1 7.5e-62 234.6
Lcy9g1162 . 137 318 SNARE and Associated Proteins AT1G79590 68.9 5.1e-67 251.9
Lcy6g1648 . 6 188 SNARE and Associated Proteins AT1G79590 67.5 8.8e-67 251.1
Lcy9g1185 . 56 247 SNARE and Associated Proteins AT1G28490 71.9 2.5e-66 249.2
Lcy5g0279 . 44 304 SNARE and Associated Proteins AT3G09740 79.5 2.6e-111 399.1
Lcy1g2796 . 1 286 SNARE and Associated Proteins AT3G09740 61.8 4.4e-90 328.6
Lcy1g2792 . 1 286 SNARE and Associated Proteins AT3G09740 61.5 2.2e-89 326.2
Lcy8g1893 . 1 283 SNARE and Associated Proteins AT3G09740 58.6 2.0e-82 303.1
Lcy5g0279 . 44 307 SNARE and Associated Proteins AT3G45280 64.0 9.1e-88 320.9
Lcy1g2796 . 1 286 SNARE and Associated Proteins AT3G45280 59.7 3.0e-83 305.8
Lcy1g2792 . 1 286 SNARE and Associated Proteins AT3G45280 59.4 1.5e-82 303.5
Lcy8g1893 . 1 283 SNARE and Associated Proteins AT3G45280 56.5 1.8e-75 280.0
Lcy5g0279 . 44 304 SNARE and Associated Proteins AT3G61450 67.8 5.8e-95 344.7
Lcy1g2792 . 1 287 SNARE and Associated Proteins AT3G61450 55.9 3.6e-81 298.9
Lcy1g2796 . 1 287 SNARE and Associated Proteins AT3G61450 55.9 4.7e-81 298.5
Lcy8g1893 . 1 284 SNARE and Associated Proteins AT3G61450 53.7 1.1e-74 277.3
Lcy4g1484 . 48 260 SNARE and Associated Proteins AT1G51740 69.0 2.6e-81 299.3
Lcy10g2218 . 37 237 SNARE and Associated Proteins AT1G51740 70.3 5.5e-71 265.0
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0010730 0 1 0 0 0 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 1 1 1 2 1 1 32