Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Lcy1g2792 ATGACCGTAATCGACATCATCTTCCGAGTCGATTCTATCTGCAAGAAATACGAGAAGTATGATGTCGAGAAACAGCGCGAGCTCAATGCTTATGGCGACGATGTCTTTGCTCGCCTCTTCGCCGCCGTTGAGGCCGAAATCGACGCCGCTCTCCAGAAATCGGAGGCTGCCTCGACCGAGAAGAATAGGGCTGCTTCAGTTGCCATGAACGCCGAGGTTCGGCGGAAGAAGGCCCGATTGATGGATGAAGTGCCTAAGCTTCGTAAATTGGCTCACAAGAAGGTTAAAGGGGTTCCGAAAGAAGAGCTTGCGGTCAGAGATGATCTTGTTCTTGGGCTCGAGGAGAGGATCAAAGCGATTCCAGATGGGAGTACCTCCGTAGGCAAACAATCTGGAGGATGGGCCTCCTCCTCCTCATCGAACAACATCAAATTTGACTCAACATCAGATGGAAACTTTGAGAGCGAGTATTTCCAGCAGAGTGAAGAATCAAGTCAATTTCGACAGGAGTATGAAATGCGGAAGATGAAACAGGCATGTGAGTTTCTTTACCAATTTTCTGCAACCAAAATTACTTTTAAGCTCATGTTAGATTGTAGGCTCGACCAAGGGCTCGATATCATATCTGAAGGGTTGGATATGCTGAAAAATCTGGCCCATGATATGAATGAGGAATTGGACAGGCAAGTTCCATTAATTGACGAGATCGACGCAAAGGTTGACAAGGTGACTAATGAGATTAAAAATACCAATGTTAGGCTCAAGGAAACACTCTATGAGGTGAGATCCAGTCAAAACTTCTGCATCGATATCATTCTTCTCTGTGTAATTCTTGGAATCGCTTCTTACTTATACAAGTAA 861 45.41 MTVIDIIFRVDSICKKYEKYDVEKQRELNAYGDDVFARLFAAVEAEIDAALQKSEAASTEKNRAASVAMNAEVRRKKARLMDEVPKLRKLAHKKVKGVPKEELAVRDDLVLGLEERIKAIPDGSTSVGKQSGGWASSSSSNNIKFDSTSDGNFESEYFQQSEESSQFRQEYEMRKMKQACEFLYQFSATKITFKLMLDCRLDQGLDIISEGLDMLKNLAHDMNEELDRQVPLIDEIDAKVDKVTNEIKNTNVRLKETLYEVRSSQNFCIDIILLCVILGIASYLYK 286
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
1 55746756 55748599 + Maker00006709 Lcy1g2792 624704

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Lcy1g2792 286 SUPERFAMILY SNARE fusion complex 200 255 - -
Lcy1g2792 286 Coils Coil 233 253 - -
Lcy1g2792 286 Gene3D - 197 256 - -
Lcy1g2792 286 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 202 257 IPR000727 -
Lcy1g2792 286 PANTHER SYNTAXIN 25 275 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0006886(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Lcy1g2792 286 MobiDBLite consensus disorder prediction 124 146 - -
Lcy1g2792 286 FunFam Syntaxin 6 202 265 - -
Lcy1g2792 286 CDD SNARE_Qc 202 256 - -
Lcy1g2792 286 SMART tSNARE_6 190 257 IPR000727 -
Lcy1g2792 286 Pfam SNARE domain 232 281 IPR000727 -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lcy1g2792 K08506 - - csv:101211289 420.624
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Lcy1g2792 Lcy-Chr1:55746756 Lcy8g1893 Lcy-Chr8:45213700 1.21E-156 dispersed
Lcy1g2792 Lcy-Chr1:55746756 Lcy1g2796 Lcy-Chr1:55792880 3.55E-191 proximal
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lcy13g1316 . 8 286 SNARE and Associated Proteins AT3G24350 63.0 1.1e-80 297.7
Lcy1g1665 . 1 309 SNARE and Associated Proteins AT1G08560 69.7 4.7e-104 375.2
Lcy11g0712 . 106 296 SNARE and Associated Proteins AT1G08560 50.5 1.1e-44 177.9
Lcy1g0704 . 405 709 SNARE and Associated Proteins AT2G18260 55.6 6.7e-87 318.2
Lcy5g0507 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.5e-115 412.1
Lcy5g2615 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.5e-115 412.1
Lcy1g1206 . 23 281 SNARE and Associated Proteins AT3G11820 72.6 1.7e-101 366.7
Lcy5g1935 . 31 281 SNARE and Associated Proteins AT3G11820 66.9 6.5e-93 338.2
Lcy11g0712 . 91 296 SNARE and Associated Proteins AT3G11820 57.3 4.3e-60 229.2
Lcy5g0507 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 8.6e-91 331.3
Lcy5g2615 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 8.6e-91 331.3
Lcy1g1206 . 1 281 SNARE and Associated Proteins AT3G52400 60.1 4.9e-86 315.5
Lcy5g1935 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 2.1e-81 300.1
Lcy11g0712 . 88 296 SNARE and Associated Proteins AT3G52400 53.6 9.3e-53 204.9
Lcy5g1935 . 1 299 SNARE and Associated Proteins AT4G03330 69.2 2.4e-108 389.4
Lcy5g0507 . 1 279 SNARE and Associated Proteins AT4G03330 57.5 1.0e-82 304.3
Lcy5g2615 . 1 279 SNARE and Associated Proteins AT4G03330 57.5 1.0e-82 304.3
Lcy1g1206 . 1 287 SNARE and Associated Proteins AT4G03330 54.3 6.8e-79 291.6
Lcy11g0712 . 91 296 SNARE and Associated Proteins AT4G03330 59.2 2.4e-60 229.9
Lcy5g1935 . 1 303 SNARE and Associated Proteins AT1G61290 78.9 1.6e-128 456.4
Lcy5g0507 . 1 279 SNARE and Associated Proteins AT1G61290 62.3 5.9e-91 331.6
Lcy5g2615 . 1 279 SNARE and Associated Proteins AT1G61290 62.3 5.9e-91 331.6
Lcy1g1206 . 1 287 SNARE and Associated Proteins AT1G61290 56.4 5.9e-83 305.1
Lcy11g0712 . 88 296 SNARE and Associated Proteins AT1G61290 54.1 4.2e-57 219.2
Lcy5g1935 . 1 303 SNARE and Associated Proteins AT1G11250 77.9 1.6e-125 446.4
Lcy5g0507 . 1 279 SNARE and Associated Proteins AT1G11250 63.1 1.6e-93 340.1
Lcy5g2615 . 1 279 SNARE and Associated Proteins AT1G11250 63.1 1.6e-93 340.1
Lcy1g1206 . 1 287 SNARE and Associated Proteins AT1G11250 57.8 5.6e-86 315.1
Lcy11g0712 . 88 296 SNARE and Associated Proteins AT1G11250 55.5 2.0e-59 226.9
Lcy11g0712 . 90 320 SNARE and Associated Proteins AT3G03800 77.5 5.3e-92 335.1
Lcy11g0712 . 90 214 SNARE and Associated Proteins AT5G08080 82.4 2.3e-52 203.0
Lcy6g2242 . 5 158 SNARE and Associated Proteins AT5G16830 59.7 7.4e-40 161.8
Lcy6g2242 . 4 129 SNARE and Associated Proteins AT5G46860 80.2 1.3e-46 184.1
Lcy6g2242 . 4 129 SNARE and Associated Proteins AT4G17730 77.0 5.9e-47 185.3
Lcy6g2242 . 2 157 SNARE and Associated Proteins AT1G32270 60.9 2.5e-42 170.2
Lcy7g0975 . 1 334 SNARE and Associated Proteins AT5G05760 66.9 4.2e-114 408.7
Lcy13g1316 . 8 286 SNARE and Associated Proteins AT3G24350 63.0 1.1e-80 297.7
Lcy4g1808 . 1 311 SNARE and Associated Proteins AT5G26980 70.4 3.3e-116 415.6
Lcy3g1779 . 1 320 SNARE and Associated Proteins AT5G26980 67.1 2.2e-104 376.3
Lcy10g0262 . 79 263 SNARE and Associated Proteins AT5G26980 58.9 2.3e-45 180.3
Lcy3g1779 . 1 320 SNARE and Associated Proteins AT4G02195 66.3 2.2e-104 376.3
Lcy4g1808 . 1 314 SNARE and Associated Proteins AT4G02195 59.1 3.9e-93 339.0
Lcy10g0262 . 79 263 SNARE and Associated Proteins AT4G02195 58.3 6.5e-48 188.7
Lcy4g1808 . 1 312 SNARE and Associated Proteins AT3G05710 68.6 1.6e-113 406.8
Lcy3g1779 . 1 323 SNARE and Associated Proteins AT3G05710 63.7 5.8e-100 361.7
Lcy10g0262 . 71 263 SNARE and Associated Proteins AT3G05710 58.0 4.1e-45 179.5
Lcy9g1162 . 137 318 SNARE and Associated Proteins AT1G16240 70.5 5.9e-67 251.5
Lcy6g1648 . 12 188 SNARE and Associated Proteins AT1G16240 68.1 7.5e-62 234.6
Lcy9g1162 . 137 318 SNARE and Associated Proteins AT1G79590 68.9 5.1e-67 251.9
Lcy6g1648 . 6 188 SNARE and Associated Proteins AT1G79590 67.5 8.8e-67 251.1
Lcy9g1185 . 56 247 SNARE and Associated Proteins AT1G28490 71.9 2.5e-66 249.2
Lcy5g0279 . 44 304 SNARE and Associated Proteins AT3G09740 79.5 2.6e-111 399.1
Lcy1g2796 . 1 286 SNARE and Associated Proteins AT3G09740 61.8 4.4e-90 328.6
Lcy1g2792 . 1 286 SNARE and Associated Proteins AT3G09740 61.5 2.2e-89 326.2
Lcy8g1893 . 1 283 SNARE and Associated Proteins AT3G09740 58.6 2.0e-82 303.1
Lcy5g0279 . 44 307 SNARE and Associated Proteins AT3G45280 64.0 9.1e-88 320.9
Lcy1g2796 . 1 286 SNARE and Associated Proteins AT3G45280 59.7 3.0e-83 305.8
Lcy1g2792 . 1 286 SNARE and Associated Proteins AT3G45280 59.4 1.5e-82 303.5
Lcy8g1893 . 1 283 SNARE and Associated Proteins AT3G45280 56.5 1.8e-75 280.0
Lcy5g0279 . 44 304 SNARE and Associated Proteins AT3G61450 67.8 5.8e-95 344.7
Lcy1g2792 . 1 287 SNARE and Associated Proteins AT3G61450 55.9 3.6e-81 298.9
Lcy1g2796 . 1 287 SNARE and Associated Proteins AT3G61450 55.9 4.7e-81 298.5
Lcy8g1893 . 1 284 SNARE and Associated Proteins AT3G61450 53.7 1.1e-74 277.3
Lcy4g1484 . 48 260 SNARE and Associated Proteins AT1G51740 69.0 2.6e-81 299.3
Lcy10g2218 . 37 237 SNARE and Associated Proteins AT1G51740 70.3 5.5e-71 265.0