Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Lcy5g0279 ATGGGCCCTTTTTCTGTGGGCTTGGCAAATTTGGGCTGTCCGCGCACAGCTTCTGGAGATATTCGAAACCGCTCTCACCGCCATAGGTCACCGGAAAACCGACCGGAGCACGGAGGCGAAGAATCGAGGATGAGCGTGATTGACCTGTTGACCAGAGTAGATGCGATCTGCCAGAAGTACGACAAATACGATGTAGAGAAGCAGAGGGATCTCAATGTCTCCGGCGATGATGCCTTTGCTCGACTCTATGCCACCGTCGAAGCCGACATTGAAGCCGCTCTCCAGAAAGCGGATGATGCTTCTAAAGAGAAGAATAGGGCGTCGGTGGTGGCGTTGAATGCGGAGATTCGTCGTACCAAGGCTCGATTACTGGAGGAGGTCCCCAAGTTGCAGAGATTGGCTGTAAAGAGGGTAAAAGGGCTATCAACTGAAGATCTTACCACTCGAAATGATTTGGTGCTTGCATTGCCGGATCGGATTCAAGCTATACCAGATGGGACTGCTACTGCAGCGAAGAAGAATGGTGGTTGGACATCCTCAGCTTCACGTACTGAAATAAAATTTGACTCAGATGGGCGATTTGATGATGAGTACTTCCAACACACTGAGGAGTCAAGCCAGTTCAGGCAAGAGTATGAAATGCGGAAAATGAAACAGGATCAAGGATTGGACATGATATCCGAAGGGTTGGATACTCTGAAGAACATGGCTCATGATATGAATGAGGAAATAGACAGGCAAGTTCCTTTGATGGACGAGATTGACACTAAGGTGGACAAAGCTGCATCTGACCTTAAAAACACCAATGTTAGATTAAAGGACACCGTTAACCAGCTAAGGTCCAGCAGAAATTTCTGTATTGATATTGTTTTGTTGTGTATAATCTTGGGTATTGCTGCCTATCTATACAACCAAGTGCAACTGAACTCTATTATGGAATGTGGAAAGTTTATGGTAGCATTACAAGTTCATGAGTCAGATCCTACCTAG 990 46.46 MGPFSVGLANLGCPRTASGDIRNRSHRHRSPENRPEHGGEESRMSVIDLLTRVDAICQKYDKYDVEKQRDLNVSGDDAFARLYATVEADIEAALQKADDASKEKNRASVVALNAEIRRTKARLLEEVPKLQRLAVKRVKGLSTEDLTTRNDLVLALPDRIQAIPDGTATAAKKNGGWTSSASRTEIKFDSDGRFDDEYFQHTEESSQFRQEYEMRKMKQDQGLDMISEGLDTLKNMAHDMNEEIDRQVPLMDEIDTKVDKAASDLKNTNVRLKDTVNQLRSSRNFCIDIVLLCIILGIAAYLYNQVQLNSIMECGKFMVALQVHESDPT 329
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
5 2615499 2619027 + Maker00033540 Lcy5g0279 632094

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Lcy5g0279 329 Gene3D - 213 274 - -
Lcy5g0279 329 PANTHER SYNTAXIN 87 293 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0006886(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Lcy5g0279 329 SMART tSNARE_6 208 275 IPR000727 -
Lcy5g0279 329 FunFam Putative syntaxin-71-like 213 274 - -
Lcy5g0279 329 CDD SNARE_Qc 218 273 - -
Lcy5g0279 329 Coils Coil 262 282 - -
Lcy5g0279 329 Coils Coil 83 103 - -
Lcy5g0279 329 Pfam SNARE domain 250 299 IPR000727 -
Lcy5g0279 329 SUPERFAMILY SNARE fusion complex 206 273 - -
Lcy5g0279 329 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 213 275 IPR000727 -
Lcy5g0279 329 MobiDBLite consensus disorder prediction 20 43 - -
Lcy5g0279 329 ProSitePatterns Syntaxin / epimorphin family signature. 219 258 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Lcy5g0279 329 MobiDBLite consensus disorder prediction 15 43 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lcy5g0279 K08506 - - csv:101215905 499.204
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Lcy5g0279 Lcy-Chr5:2615499 Lcy8g1893 Lcy-Chr8:45213700 3.24E-108 wgd
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lcy13g1316 . 8 286 SNARE and Associated Proteins AT3G24350 63.0 1.1e-80 297.7
Lcy1g1665 . 1 309 SNARE and Associated Proteins AT1G08560 69.7 4.7e-104 375.2
Lcy11g0712 . 106 296 SNARE and Associated Proteins AT1G08560 50.5 1.1e-44 177.9
Lcy1g0704 . 405 709 SNARE and Associated Proteins AT2G18260 55.6 6.7e-87 318.2
Lcy5g0507 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.5e-115 412.1
Lcy5g2615 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.5e-115 412.1
Lcy1g1206 . 23 281 SNARE and Associated Proteins AT3G11820 72.6 1.7e-101 366.7
Lcy5g1935 . 31 281 SNARE and Associated Proteins AT3G11820 66.9 6.5e-93 338.2
Lcy11g0712 . 91 296 SNARE and Associated Proteins AT3G11820 57.3 4.3e-60 229.2
Lcy5g0507 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 8.6e-91 331.3
Lcy5g2615 . 1 279 SNARE and Associated Proteins AT3G52400 63.6 8.6e-91 331.3
Lcy1g1206 . 1 281 SNARE and Associated Proteins AT3G52400 60.1 4.9e-86 315.5
Lcy5g1935 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 2.1e-81 300.1
Lcy11g0712 . 88 296 SNARE and Associated Proteins AT3G52400 53.6 9.3e-53 204.9
Lcy5g1935 . 1 299 SNARE and Associated Proteins AT4G03330 69.2 2.4e-108 389.4
Lcy5g0507 . 1 279 SNARE and Associated Proteins AT4G03330 57.5 1.0e-82 304.3
Lcy5g2615 . 1 279 SNARE and Associated Proteins AT4G03330 57.5 1.0e-82 304.3
Lcy1g1206 . 1 287 SNARE and Associated Proteins AT4G03330 54.3 6.8e-79 291.6
Lcy11g0712 . 91 296 SNARE and Associated Proteins AT4G03330 59.2 2.4e-60 229.9
Lcy5g1935 . 1 303 SNARE and Associated Proteins AT1G61290 78.9 1.6e-128 456.4
Lcy5g0507 . 1 279 SNARE and Associated Proteins AT1G61290 62.3 5.9e-91 331.6
Lcy5g2615 . 1 279 SNARE and Associated Proteins AT1G61290 62.3 5.9e-91 331.6
Lcy1g1206 . 1 287 SNARE and Associated Proteins AT1G61290 56.4 5.9e-83 305.1
Lcy11g0712 . 88 296 SNARE and Associated Proteins AT1G61290 54.1 4.2e-57 219.2
Lcy5g1935 . 1 303 SNARE and Associated Proteins AT1G11250 77.9 1.6e-125 446.4
Lcy5g0507 . 1 279 SNARE and Associated Proteins AT1G11250 63.1 1.6e-93 340.1
Lcy5g2615 . 1 279 SNARE and Associated Proteins AT1G11250 63.1 1.6e-93 340.1
Lcy1g1206 . 1 287 SNARE and Associated Proteins AT1G11250 57.8 5.6e-86 315.1
Lcy11g0712 . 88 296 SNARE and Associated Proteins AT1G11250 55.5 2.0e-59 226.9
Lcy11g0712 . 90 320 SNARE and Associated Proteins AT3G03800 77.5 5.3e-92 335.1
Lcy11g0712 . 90 214 SNARE and Associated Proteins AT5G08080 82.4 2.3e-52 203.0
Lcy6g2242 . 5 158 SNARE and Associated Proteins AT5G16830 59.7 7.4e-40 161.8
Lcy6g2242 . 4 129 SNARE and Associated Proteins AT5G46860 80.2 1.3e-46 184.1
Lcy6g2242 . 4 129 SNARE and Associated Proteins AT4G17730 77.0 5.9e-47 185.3
Lcy6g2242 . 2 157 SNARE and Associated Proteins AT1G32270 60.9 2.5e-42 170.2
Lcy7g0975 . 1 334 SNARE and Associated Proteins AT5G05760 66.9 4.2e-114 408.7
Lcy13g1316 . 8 286 SNARE and Associated Proteins AT3G24350 63.0 1.1e-80 297.7
Lcy4g1808 . 1 311 SNARE and Associated Proteins AT5G26980 70.4 3.3e-116 415.6
Lcy3g1779 . 1 320 SNARE and Associated Proteins AT5G26980 67.1 2.2e-104 376.3
Lcy10g0262 . 79 263 SNARE and Associated Proteins AT5G26980 58.9 2.3e-45 180.3
Lcy3g1779 . 1 320 SNARE and Associated Proteins AT4G02195 66.3 2.2e-104 376.3
Lcy4g1808 . 1 314 SNARE and Associated Proteins AT4G02195 59.1 3.9e-93 339.0
Lcy10g0262 . 79 263 SNARE and Associated Proteins AT4G02195 58.3 6.5e-48 188.7
Lcy4g1808 . 1 312 SNARE and Associated Proteins AT3G05710 68.6 1.6e-113 406.8
Lcy3g1779 . 1 323 SNARE and Associated Proteins AT3G05710 63.7 5.8e-100 361.7
Lcy10g0262 . 71 263 SNARE and Associated Proteins AT3G05710 58.0 4.1e-45 179.5
Lcy9g1162 . 137 318 SNARE and Associated Proteins AT1G16240 70.5 5.9e-67 251.5
Lcy6g1648 . 12 188 SNARE and Associated Proteins AT1G16240 68.1 7.5e-62 234.6
Lcy9g1162 . 137 318 SNARE and Associated Proteins AT1G79590 68.9 5.1e-67 251.9
Lcy6g1648 . 6 188 SNARE and Associated Proteins AT1G79590 67.5 8.8e-67 251.1
Lcy9g1185 . 56 247 SNARE and Associated Proteins AT1G28490 71.9 2.5e-66 249.2
Lcy5g0279 . 44 304 SNARE and Associated Proteins AT3G09740 79.5 2.6e-111 399.1
Lcy1g2796 . 1 286 SNARE and Associated Proteins AT3G09740 61.8 4.4e-90 328.6
Lcy1g2792 . 1 286 SNARE and Associated Proteins AT3G09740 61.5 2.2e-89 326.2
Lcy8g1893 . 1 283 SNARE and Associated Proteins AT3G09740 58.6 2.0e-82 303.1
Lcy5g0279 . 44 307 SNARE and Associated Proteins AT3G45280 64.0 9.1e-88 320.9
Lcy1g2796 . 1 286 SNARE and Associated Proteins AT3G45280 59.7 3.0e-83 305.8
Lcy1g2792 . 1 286 SNARE and Associated Proteins AT3G45280 59.4 1.5e-82 303.5
Lcy8g1893 . 1 283 SNARE and Associated Proteins AT3G45280 56.5 1.8e-75 280.0
Lcy5g0279 . 44 304 SNARE and Associated Proteins AT3G61450 67.8 5.8e-95 344.7
Lcy1g2792 . 1 287 SNARE and Associated Proteins AT3G61450 55.9 3.6e-81 298.9
Lcy1g2796 . 1 287 SNARE and Associated Proteins AT3G61450 55.9 4.7e-81 298.5
Lcy8g1893 . 1 284 SNARE and Associated Proteins AT3G61450 53.7 1.1e-74 277.3
Lcy4g1484 . 48 260 SNARE and Associated Proteins AT1G51740 69.0 2.6e-81 299.3
Lcy10g2218 . 37 237 SNARE and Associated Proteins AT1G51740 70.3 5.5e-71 265.0
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002038 1 2 1 1 1 2 3 2 2 2 2 2 3 3 2 3 2 2 3 2 3 2 2 2 2 2 3 2 2 2 63