Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Lcy7g1305 ATGGCAGCTTCATCGATGGCTCTGCCTTCCCCATCTCTGGCTGGCCAAGCCGTGAAACTGTCCCCTGCCGCCTCTGACCTCCTCGGCGACGGTCGTGTCACCATGAGGAAAACCGTCGGCAAGCCCAAGCTCGTCTCCTCCGGAAGCCCATGGTACGGCCCAGATCGCGTCAAGTACTTGGGCCCATTCTCCGGCGAGCCCCCGTCCTATCTGACCGGCGAGTTCCCCGGCAACTACGGCTGGGACACCGTCGGCCTCTCTGCCGACCCCAAGACCTTCGCCAAGAACCGCGAGCTCGAAGTAATCCACTCGAGATGGGCCATGCTCGGGGCTCTCGGCTGCGTGTTCCTCGAGCTCCTCTCTCGCAACGACGTCAAATTTGGCGAGGCCGTGTGGTTCAAAGTCGGCTCGCAGATCTTCAGCGAAGGTGGGCTAGACTATTTGGGCAACCCGAGCCTAGTCCATGCTCCAGACCTCGTCGAAACGGGGAGGAGGGTTTCCTCCTCCCCATTCCAGCATTAA 522 61.49 MAASSMALPSPSLAGQAVKLSPAASDLLGDGRVTMRKTVGKPKLVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGNYGWDTVGLSADPKTFAKNRELEVIHSRWAMLGALGCVFLELLSRNDVKFGEAVWFKVGSQIFSEGGLDYLGNPSLVHAPDLVETGRRVSSSPFQH 173
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
7 18083029 18083550 + Maker00028444 Lcy7g1305 638137

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Lcy7g1305 173 SUPERFAMILY Chlorophyll a-b binding protein 50 156 - -
Lcy7g1305 173 Gene3D Chlorophyll a/b binding protein domain 58 166 - -
Lcy7g1305 173 FunFam Chlorophyll a-b binding protein, chloroplastic 58 150 - -
Lcy7g1305 173 Pfam Chlorophyll A-B binding protein 67 138 IPR022796 -
Lcy7g1305 173 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 4 159 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0009941(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lcy7g1305 K08912 - - csv:101213845 295.049
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Lcy7g1305 Lcy-Chr7:18083029 Lcy8g1625 Lcy-Chr8:42832368 9.20E-94 dispersed
Lcy2g1692 Lcy-Chr2:25394891 Lcy7g1305 Lcy-Chr7:18083029 4.45E-59 wgd
Lcy7g1305 Lcy-Chr7:18083029 Lcy9g0400 Lcy-Chr9:11290025 1.16E-17 wgd
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lcy13g1727 . 73 410 Chloroplast and Mitochondria Gene Families AT2G28800 51.9 4.9e-83 305.8
Lcy11g0201 . 1 313 Chloroplast and Mitochondria Gene Families AT2G28800 52.2 9.3e-74 275.0
Lcy10g1345 . 3 264 Chloroplast and Mitochondria Gene Families AT1G15820 78.0 7.6e-116 414.1
Lcy9g0892 . 22 204 Chloroplast and Mitochondria Gene Families AT1G15820 79.8 1.1e-85 313.9
Lcy4g0371 . 1 266 Chloroplast and Mitochondria Gene Families AT3G27690 89.9 1.5e-144 509.6
Lcy1g0204 . 2 266 Chloroplast and Mitochondria Gene Families AT3G27690 77.5 7.0e-121 431.0
Lcy1g0203 . 2 266 Chloroplast and Mitochondria Gene Families AT3G27690 77.1 1.6e-120 429.9
Lcy12g0389 . 179 447 Chloroplast and Mitochondria Gene Families AT3G27690 76.5 5.9e-120 427.9
Lcy5g1745 . 111 378 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 1.0e-119 427.2
Lcy5g1744 . 2 266 Chloroplast and Mitochondria Gene Families AT3G27690 77.5 1.7e-119 426.4
Lcy5g1746 . 2 266 Chloroplast and Mitochondria Gene Families AT3G27690 77.5 1.7e-119 426.4
Lcy8g1625 . 2 263 Chloroplast and Mitochondria Gene Families AT3G27690 78.1 1.5e-118 423.3
Lcy6g1248 . 131 351 Chloroplast and Mitochondria Gene Families AT3G27690 76.6 1.3e-95 347.1
Lcy7g1305 . 2 160 Chloroplast and Mitochondria Gene Families AT3G27690 65.7 2.7e-56 216.5
Lcy2g0986 . 54 259 Chloroplast and Mitochondria Gene Families AT3G61470 65.5 1.1e-85 313.9
Lcy7g0042 . 1 151 Chloroplast and Mitochondria Gene Families AT3G61470 92.7 1.2e-84 310.5
Lcy2g0568 . 22 249 Chloroplast and Mitochondria Gene Families AT3G61470 51.7 8.0e-65 244.6
Lcy5g2537 . 22 245 Chloroplast and Mitochondria Gene Families AT3G61470 51.1 1.7e-62 236.9
Lcy13g2071 . 42 252 Chloroplast and Mitochondria Gene Families AT3G61470 50.5 1.4e-53 207.2
Lcy10g1770 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 82.1 1.6e-90 329.7
Lcy10g1511 . 1 161 Chloroplast and Mitochondria Gene Families AT3G54890 77.0 3.9e-65 245.4
Lcy1g1546 . 1 287 Chloroplast and Mitochondria Gene Families AT3G08940 82.4 1.8e-134 476.1
Lcy5g0115 . 5 286 Chloroplast and Mitochondria Gene Families AT3G08940 83.7 2.6e-133 472.2
Lcy9g2374 . 3 177 Chloroplast and Mitochondria Gene Families AT1G76570 81.7 1.1e-87 320.9
Lcy2g1328 . 1 293 Chloroplast and Mitochondria Gene Families AT1G61520 80.2 1.4e-131 466.5
Lcy4g0371 . 1 266 Chloroplast and Mitochondria Gene Families AT2G05070 89.8 2.3e-144 508.8
Lcy1g0204 . 4 266 Chloroplast and Mitochondria Gene Families AT2G05070 78.7 2.4e-120 429.1
Lcy1g0203 . 5 266 Chloroplast and Mitochondria Gene Families AT2G05070 78.7 5.3e-120 427.9
Lcy5g1744 . 5 266 Chloroplast and Mitochondria Gene Families AT2G05070 79.0 9.0e-120 427.2
Lcy5g1746 . 5 266 Chloroplast and Mitochondria Gene Families AT2G05070 79.0 9.0e-120 427.2
Lcy5g1745 . 117 378 Chloroplast and Mitochondria Gene Families AT2G05070 79.0 9.0e-120 427.2
Lcy12g0389 . 208 447 Chloroplast and Mitochondria Gene Families AT2G05070 83.8 1.4e-117 419.9
Lcy8g1625 . 7 263 Chloroplast and Mitochondria Gene Families AT2G05070 79.0 3.2e-117 418.7
Lcy6g1248 . 131 351 Chloroplast and Mitochondria Gene Families AT2G05070 77.0 1.2e-95 347.1
Lcy7g1305 . 7 160 Chloroplast and Mitochondria Gene Families AT2G05070 67.9 8.3e-57 218.0
Lcy4g0371 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.9 1.7e-125 446.4
Lcy1g0204 . 4 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.1 2.2e-101 366.3
Lcy1g0203 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.9 5.0e-101 365.2
Lcy5g1744 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.4 5.0e-101 365.2
Lcy5g1746 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.4 5.0e-101 365.2
Lcy5g1745 . 117 349 Chloroplast and Mitochondria Gene Families AT2G05100 77.4 5.0e-101 365.2
Lcy8g1625 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 77.4 5.0e-101 365.2
Lcy12g0389 . 189 418 Chloroplast and Mitochondria Gene Families AT2G05100 77.6 1.6e-99 360.1
Lcy6g1248 . 131 322 Chloroplast and Mitochondria Gene Families AT2G05100 76.7 8.3e-80 294.7
Lcy7g1305 . 7 160 Chloroplast and Mitochondria Gene Families AT2G05100 68.1 4.9e-56 215.7
Lcy1g1546 . 4 168 Chloroplast and Mitochondria Gene Families AT2G40100 73.4 2.8e-67 252.3
Lcy5g0115 . 1 171 Chloroplast and Mitochondria Gene Families AT2G40100 68.0 4.1e-63 238.4
Lcy1g0203 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 89.2 2.4e-136 482.3
Lcy5g1744 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 88.1 4.0e-136 481.5
Lcy5g1746 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 88.1 4.0e-136 481.5
Lcy1g0204 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 5.3e-136 481.1
Lcy5g1745 . 113 378 Chloroplast and Mitochondria Gene Families AT1G29930 87.7 9.0e-136 480.3
Lcy8g1625 . 1 263 Chloroplast and Mitochondria Gene Families AT1G29930 89.0 4.9e-134 474.6
Lcy12g0389 . 185 447 Chloroplast and Mitochondria Gene Families AT1G29930 85.3 3.8e-126 448.4
Lcy4g0371 . 3 266 Chloroplast and Mitochondria Gene Families AT1G29930 78.4 2.7e-116 415.6
Lcy6g1248 . 132 351 Chloroplast and Mitochondria Gene Families AT1G29930 75.1 5.0e-94 341.7
Lcy7g1305 . 1 160 Chloroplast and Mitochondria Gene Families AT1G29930 83.1 4.1e-72 268.9
Lcy2g1692 . 1 119 Chloroplast and Mitochondria Gene Families AT1G29930 75.6 5.8e-42 168.7
Lcy1g0203 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 88.8 9.0e-136 480.3
Lcy5g1744 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 87.7 1.5e-135 479.6
Lcy5g1746 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 87.7 1.5e-135 479.6
Lcy1g0204 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 2.0e-135 479.2
Lcy5g1745 . 113 378 Chloroplast and Mitochondria Gene Families AT1G29920 87.3 3.4e-135 478.4
Lcy8g1625 . 1 263 Chloroplast and Mitochondria Gene Families AT1G29920 89.0 3.8e-134 474.9
Lcy12g0389 . 185 447 Chloroplast and Mitochondria Gene Families AT1G29920 85.3 4.9e-126 448.0
Lcy4g0371 . 3 266 Chloroplast and Mitochondria Gene Families AT1G29920 78.0 1.6e-116 416.4
Lcy6g1248 . 132 351 Chloroplast and Mitochondria Gene Families AT1G29920 75.1 5.0e-94 341.7
Lcy7g1305 . 1 160 Chloroplast and Mitochondria Gene Families AT1G29920 82.5 1.6e-71 266.9
Lcy2g1692 . 1 119 Chloroplast and Mitochondria Gene Families AT1G29920 74.8 2.2e-41 166.8
Lcy1g0203 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 88.8 9.0e-136 480.3
Lcy5g1744 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 87.7 1.5e-135 479.6
Lcy5g1746 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 87.7 1.5e-135 479.6
Lcy1g0204 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 2.0e-135 479.2
Lcy5g1745 . 113 378 Chloroplast and Mitochondria Gene Families AT1G29910 87.3 3.4e-135 478.4
Lcy8g1625 . 1 263 Chloroplast and Mitochondria Gene Families AT1G29910 89.0 3.8e-134 474.9
Lcy12g0389 . 185 447 Chloroplast and Mitochondria Gene Families AT1G29910 85.3 4.9e-126 448.0
Lcy4g0371 . 3 266 Chloroplast and Mitochondria Gene Families AT1G29910 78.0 1.6e-116 416.4
Lcy6g1248 . 132 351 Chloroplast and Mitochondria Gene Families AT1G29910 75.1 5.0e-94 341.7
Lcy7g1305 . 1 160 Chloroplast and Mitochondria Gene Families AT1G29910 82.5 1.6e-71 266.9
Lcy2g1692 . 1 119 Chloroplast and Mitochondria Gene Families AT1G29910 74.8 2.2e-41 166.8
Lcy9g0400 . 11 304 Chloroplast and Mitochondria Gene Families AT4G10340 80.6 2.6e-133 472.2
Lcy5g1744 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 6.7e-57 218.4
Lcy5g1746 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 6.7e-57 218.4
Lcy1g0204 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 1.1e-56 217.6
Lcy1g0203 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 1.1e-56 217.6
Lcy5g1745 . 149 365 Chloroplast and Mitochondria Gene Families AT4G10340 51.6 1.5e-56 217.2
Lcy8g1625 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.5e-56 217.2
Lcy12g0389 . 230 434 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.5e-56 217.2
Lcy4g0371 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 4.0e-54 209.1
Lcy6g1248 . 132 338 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 3.8e-52 202.6
Lcy5g1744 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34420 87.7 7.5e-135 477.2
Lcy5g1746 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34420 87.7 7.5e-135 477.2
Lcy1g0203 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 9.9e-135 476.9
Lcy5g1745 . 113 378 Chloroplast and Mitochondria Gene Families AT2G34420 87.3 1.7e-134 476.1
Lcy1g0204 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34420 88.1 2.2e-134 475.7
Lcy8g1625 . 1 263 Chloroplast and Mitochondria Gene Families AT2G34420 89.0 2.4e-133 472.2
Lcy12g0389 . 185 447 Chloroplast and Mitochondria Gene Families AT2G34420 85.7 7.6e-127 450.7
Lcy4g0371 . 3 266 Chloroplast and Mitochondria Gene Families AT2G34420 77.2 5.4e-117 417.9
Lcy6g1248 . 132 351 Chloroplast and Mitochondria Gene Families AT2G34420 75.6 6.5e-94 341.3
Lcy7g1305 . 1 160 Chloroplast and Mitochondria Gene Families AT2G34420 82.5 4.5e-71 265.4
Lcy2g1692 . 1 119 Chloroplast and Mitochondria Gene Families AT2G34420 73.9 2.4e-40 163.3
Lcy1g0203 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34430 89.9 1.4e-136 483.0
Lcy5g1744 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 1.8e-136 482.6
Lcy5g1746 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 1.8e-136 482.6
Lcy1g0204 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34430 89.6 3.1e-136 481.9
Lcy5g1745 . 113 378 Chloroplast and Mitochondria Gene Families AT2G34430 87.3 4.0e-136 481.5
Lcy8g1625 . 1 263 Chloroplast and Mitochondria Gene Families AT2G34430 87.9 9.3e-133 470.3
Lcy12g0389 . 185 447 Chloroplast and Mitochondria Gene Families AT2G34430 86.0 1.1e-128 456.8
Lcy4g0371 . 31 266 Chloroplast and Mitochondria Gene Families AT2G34430 83.3 1.5e-114 409.8
Lcy6g1248 . 132 351 Chloroplast and Mitochondria Gene Families AT2G34430 75.6 8.5e-94 340.9
Lcy7g1305 . 1 160 Chloroplast and Mitochondria Gene Families AT2G34430 80.6 1.5e-69 260.4
Lcy2g1692 . 1 119 Chloroplast and Mitochondria Gene Families AT2G34430 74.8 4.4e-42 169.1
Lcy5g0115 . 1 286 Chloroplast and Mitochondria Gene Families AT5G01530 85.5 3.2e-139 491.9
Lcy1g1546 . 1 287 Chloroplast and Mitochondria Gene Families AT5G01530 82.8 1.0e-137 486.9
Lcy6g1094 . 48 308 Chloroplast and Mitochondria Gene Families AT5G40810 93.9 6.7e-144 507.3
Lcy6g1094 . 1 308 Chloroplast and Mitochondria Gene Families AT3G27240 85.9 5.6e-150 527.7
Lcy8g1714 . 5 334 Chloroplast and Mitochondria Gene Families AT2G30160 74.3 2.1e-142 502.7
Lcy1g1585 . 18 319 Chloroplast and Mitochondria Gene Families AT2G30160 68.1 2.6e-116 416.0
Lcy8g1714 . 5 336 Chloroplast and Mitochondria Gene Families AT1G07030 74.3 1.1e-140 496.9
Lcy1g1585 . 14 319 Chloroplast and Mitochondria Gene Families AT1G07030 70.7 1.4e-122 436.8
Lcy3g1776 . 1 341 Chloroplast and Mitochondria Gene Families AT2G47490 68.7 1.2e-128 456.8
Lcy10g1474 . 11 364 Chloroplast and Mitochondria Gene Families AT2G47490 53.2 8.4e-101 364.4
Lcy10g1474 . 10 414 Chloroplast and Mitochondria Gene Families AT1G25380 56.4 5.1e-118 421.8
Lcy3g1776 . 11 333 Chloroplast and Mitochondria Gene Families AT1G25380 56.8 3.1e-99 359.4
Lcy4g0618 . 4 584 Chloroplast and Mitochondria Gene Families AT4G21490 63.6 8.8e-221 763.8
Lcy8g1504 . 1 544 Chloroplast and Mitochondria Gene Families AT4G21490 64.6 1.7e-216 749.6
Lcy5g1939 . 5 520 Chloroplast and Mitochondria Gene Families AT4G21490 72.0 1.5e-215 746.5
Lcy2g1698 . 4 179 Chloroplast and Mitochondria Gene Families AT1G17530 58.4 6.1e-51 198.0
Lcy2g1698 . 12 184 Chloroplast and Mitochondria Gene Families AT3G04800 59.2 1.3e-51 200.3
Lcy2g1698 . 5 184 Chloroplast and Mitochondria Gene Families AT1G72750 58.5 1.1e-52 203.8
Lcy7g0409 . 1 240 Chloroplast and Mitochondria Gene Families AT1G26100 59.2 6.6e-74 274.6
Lcy10g2110 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 70.5 8.4e-90 327.4
Lcy12g0015 . 23 261 Chloroplast and Mitochondria Gene Families AT4G25570 58.5 1.9e-75 280.0
Lcy10g1034 . 9 417 Chloroplast and Mitochondria Gene Families AT5G14040 71.7 1.9e-163 572.8
Lcy10g0054 . 9 365 Chloroplast and Mitochondria Gene Families AT5G14040 75.8 1.1e-155 547.0
Lcy2g0022 . 39 329 Chloroplast and Mitochondria Gene Families AT5G14040 86.6 9.0e-150 527.3
Lcy4g0439 . 11 292 Chloroplast and Mitochondria Gene Families AT5G14040 51.0 1.8e-81 300.4
Lcy10g0054 . 6 365 Chloroplast and Mitochondria Gene Families AT3G48850 70.5 2.3e-142 502.7
Lcy2g0022 . 6 329 Chloroplast and Mitochondria Gene Families AT3G48850 69.4 1.4e-136 483.4
Lcy10g1034 . 8 405 Chloroplast and Mitochondria Gene Families AT3G48850 62.3 3.2e-136 482.3
Lcy4g0439 . 8 298 Chloroplast and Mitochondria Gene Families AT2G17270 73.8 1.7e-125 446.4
Lcy10g0054 . 67 365 Chloroplast and Mitochondria Gene Families AT2G17270 52.3 7.6e-86 314.7
Lcy2g0022 . 44 328 Chloroplast and Mitochondria Gene Families AT2G17270 50.2 2.1e-80 296.6
Lcy10g2070 . 16 312 Chloroplast and Mitochondria Gene Families AT5G15640 77.3 1.6e-128 456.4
Lcy11g1313 . 17 317 Chloroplast and Mitochondria Gene Families AT5G15640 50.2 2.4e-79 293.1
Lcy6g0134 . 176 257 Chloroplast and Mitochondria Gene Families AT5G52570 91.5 1.4e-39 160.6
Lcy12g1621 . 23 213 Chloroplast and Mitochondria Gene Families AT4G25700 60.6 1.4e-60 230.3
Lcy4g0619 . 130 305 Chloroplast and Mitochondria Gene Families AT4G03320 52.5 2.0e-56 216.9
Lcy6g1237 . 52 359 Chloroplast and Mitochondria Gene Families AT5G54290 75.5 1.8e-120 429.9
Lcy2g0229 . 100 583 Chloroplast and Mitochondria Gene Families AT2G18710 85.5 2.7e-235 812.0
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0024119 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 1 0 0 0 0 3