Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Lsi01g01574 ATGGCTACAAGCGTCTCGCACTCTCCCGATTTCCGCCCTGAAGTTTCAGTTACGCCGCCGACCCATGACGGCCTTTATTTCTGGCAGTTTATGATCGCCGGGTCAATTGCAGGGTCGGTCGAGCACATGGCGATGTATCCAGTGGATACTCTCAAGACCCGAATACAAGCCCTCGGCGGTGGATCGTCAACAGTCCGACAAGCACTCGGCTCGATTCTGAAGGTGGAAGGTCCGGCAGGGCTCTACCGTGGAATCGGAGCAATGGGTTTGGGAGCAGGACCTGCACACGCAGTCTATTTCTCAGTATATGAGTTTTGCAAAGAAGGGTTTTCAATGGGAAATAACAACAACCCATTAGCGCACGCCATTGCTGGAGTTTGTGCGACGGTGACGAGCGACGCAGTGATAACGCCGATGGATGTGGTGAAACAGAGGCTGCAGTTGAAGAGTAGTCCATATAAAGGAGTGGGAGAGTGTGTGAGGAGGATTTTGGTTGAGGAAGGAATTGGGGCGCTGTATGCTTCTTATCGGACGACGGTTGTGATGAATGCGCCGTATACGGCGGTGTATTTTGCGACTTATGAAGCTGCAAAAAGGGGATTGAAGGAGGTGTCGCCGGGAAGTGACAACGACGAGAGGCTGATTGTTCATGCTACGGCTGGTGCGGCAGCTGGGTCTCTTGCTGCTGCTCTTACAACACCATTAGACGTTGTGAAAACTCGGCTCCAGTGCCAGGGAGTATGTGGCTGTGACAAATTTTCAAGCAGTTCAATTGGGTACGTACTTGGGTGTGTGGTGAAGAAAGACGGCTACAGTGGGCTGATGAAGGGATGGATTCCAAGGATAATGTTCCATGCCCCTGCTGCTGCAATTTGCTGGTCCACTTATGAGGCTTCAAAAACCTTCTTTCAACATCTCCACAATAACAACAATTAG 936 51.18 MATSVSHSPDFRPEVSVTPPTHDGLYFWQFMIAGSIAGSVEHMAMYPVDTLKTRIQALGGGSSTVRQALGSILKVEGPAGLYRGIGAMGLGAGPAHAVYFSVYEFCKEGFSMGNNNNPLAHAIAGVCATVTSDAVITPMDVVKQRLQLKSSPYKGVGECVRRILVEEGIGALYASYRTTVVMNAPYTAVYFATYEAAKRGLKEVSPGSDNDERLIVHATAGAAAGSLAAALTTPLDVVKTRLQCQGVCGCDKFSSSSIGYVLGCVVKKDGYSGLMKGWIPRIMFHAPAAAICWSTYEASKTFFQHLHNNNN 311
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
1 13942708 13945585 + Lsi01G015740.1 Lsi01g01574 654232

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Lsi01g01574 311 ProSiteProfiles Solute carrier (Solcar) repeat profile. 25 109 IPR018108 -
Lsi01g01574 311 ProSiteProfiles Solute carrier (Solcar) repeat profile. 116 200 IPR018108 -
Lsi01g01574 311 PRINTS Mitochondrial carrier protein signature 173 191 IPR002067 GO:0055085
Lsi01g01574 311 PRINTS Mitochondrial carrier protein signature 30 43 IPR002067 GO:0055085
Lsi01g01574 311 PRINTS Mitochondrial carrier protein signature 43 57 IPR002067 GO:0055085
Lsi01g01574 311 PRINTS Mitochondrial carrier protein signature 131 149 IPR002067 GO:0055085
Lsi01g01574 311 PRINTS Mitochondrial carrier protein signature 221 243 IPR002067 GO:0055085
Lsi01g01574 311 Pfam Mitochondrial carrier protein 117 202 IPR018108 -
Lsi01g01574 311 Pfam Mitochondrial carrier protein 26 111 IPR018108 -
Lsi01g01574 311 Pfam Mitochondrial carrier protein 213 305 IPR018108 -
Lsi01g01574 311 Gene3D Mitochondrial carrier domain 110 311 IPR023395 -
Lsi01g01574 311 SUPERFAMILY Mitochondrial carrier 23 297 IPR023395 -
Lsi01g01574 311 PANTHER MITOFERRIN-1-RELATED 2 311 - -
Lsi01g01574 311 PANTHER MITOFERRIN-LIKE 2 311 - -
Lsi01g01574 311 ProSiteProfiles Solute carrier (Solcar) repeat profile. 212 302 IPR018108 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lsi01g01574 K15113 SLC25A28_37, MFRN; solute carrier family 25 (mitochondrial iron transporter), member 28/37 - csv:101210464 599.742
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Lsi01g01574 Lsi-Chr1:13942708 Lsi10g01460 Lsi-Chr10:18705393 4.66E-12 dispersed
Lsi01g01574 Lsi-Chr1:13942708 Lsi08g01194 Lsi-Chr8:20513216 3.42E-13 transposed
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi8g316 . . . . . . . . . . Cma03g00330 Cma07g01076 Car03g00292 Car07g01060 Sed03g2513 . . Bhi03g02177 Tan03g0759 Cmetu08g1077 . Hepe04g0728 . . Cla04g00684 Cam04g0686 Cec04g0807 Cco04g0860 Clacu04g0732 Cmu04g0726 Cre04g0775 . . . . Lsi01g01574 Csa04g01643 Chy08g00612 . . . . . . . . . . Cmo03g00342 Cmo07g01125 . . . . . Cpe19g00268 . . . . . . . . . . . . . . . . . Cme08g02177
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lsi02g01367 . 1 397 Chloroplast and Mitochondria Gene Families AT2G28800 63.7 6.6e-135 477.6
Lsi08g01627 . 63 427 Chloroplast and Mitochondria Gene Families AT2G28800 53.8 5.9e-99 358.2
Lsi08g00548 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 81.2 2.6e-118 421.8
Lsi11g01355 . 46 314 Chloroplast and Mitochondria Gene Families AT3G27690 87.8 4.6e-143 504.2
Lsi10g01537 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 78.8 2.4e-120 428.7
Lsi01g00172 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 9.3e-120 426.8
Lsi01g00173 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 9.3e-120 426.8
Lsi02g00880 . 43 307 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 3.5e-119 424.9
Lsi03g01151 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.2 7.8e-119 423.7
Lsi02g00879 . 2 246 Chloroplast and Mitochondria Gene Families AT3G27690 71.9 6.2e-108 387.5
Lsi05g00685 . 3 264 Chloroplast and Mitochondria Gene Families AT3G27690 67.6 7.6e-98 354.0
Lsi02g00878 . 5 166 Chloroplast and Mitochondria Gene Families AT3G27690 71.9 1.1e-64 243.8
Lsi04g00683 . 3 262 Chloroplast and Mitochondria Gene Families AT3G61470 80.5 4.1e-124 441.0
Lsi06g00351 . 56 247 Chloroplast and Mitochondria Gene Families AT3G61470 66.1 2.1e-80 295.8
Lsi06g01458 . 378 605 Chloroplast and Mitochondria Gene Families AT3G61470 51.3 4.8e-64 241.5
Lsi02g01721 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 82.1 2.5e-90 328.6
Lsi03g02207 . 3 280 Chloroplast and Mitochondria Gene Families AT3G08940 85.3 1.3e-134 476.1
Lsi01g01533 . 3 284 Chloroplast and Mitochondria Gene Families AT3G08940 82.3 5.4e-133 470.7
Lsi06g00634 . 1 273 Chloroplast and Mitochondria Gene Families AT1G61520 85.3 1.9e-135 478.8
Lsi11g01355 . 50 314 Chloroplast and Mitochondria Gene Families AT2G05070 89.4 2.8e-144 508.1
Lsi10g01537 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 79.7 2.2e-120 428.7
Lsi01g00172 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 2.8e-120 428.3
Lsi01g00173 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 2.8e-120 428.3
Lsi02g00880 . 46 307 Chloroplast and Mitochondria Gene Families AT2G05070 77.8 1.6e-118 422.5
Lsi03g01151 . 27 265 Chloroplast and Mitochondria Gene Families AT2G05070 84.1 2.7e-118 421.8
Lsi02g00879 . 5 246 Chloroplast and Mitochondria Gene Families AT2G05070 73.3 3.2e-108 388.3
Lsi05g00685 . 5 264 Chloroplast and Mitochondria Gene Families AT2G05070 68.8 4.0e-98 354.8
Lsi02g00878 . 6 166 Chloroplast and Mitochondria Gene Families AT2G05070 72.7 2.9e-64 242.3
Lsi11g01355 . 50 286 Chloroplast and Mitochondria Gene Families AT2G05100 89.5 1.6e-125 446.0
Lsi10g01537 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 77.7 1.6e-101 366.3
Lsi01g00172 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.5 1.6e-101 366.3
Lsi01g00173 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.5 1.6e-101 366.3
Lsi02g00880 . 46 279 Chloroplast and Mitochondria Gene Families AT2G05100 76.1 1.7e-100 362.8
Lsi03g01151 . 8 237 Chloroplast and Mitochondria Gene Families AT2G05100 78.0 2.3e-100 362.5
Lsi02g00879 . 5 218 Chloroplast and Mitochondria Gene Families AT2G05100 71.1 1.4e-89 326.6
Lsi05g00685 . 5 236 Chloroplast and Mitochondria Gene Families AT2G05100 68.5 3.3e-83 305.4
Lsi02g00878 . 6 166 Chloroplast and Mitochondria Gene Families AT2G05100 72.7 1.2e-64 243.8
Lsi01g01533 . 3 167 Chloroplast and Mitochondria Gene Families AT2G40100 72.8 5.7e-67 250.8
Lsi03g02207 . 3 166 Chloroplast and Mitochondria Gene Families AT2G40100 69.2 6.5e-63 237.3
Lsi10g01537 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 4.4e-137 484.2
Lsi01g00172 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 1.1e-135 479.6
Lsi01g00173 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 1.1e-135 479.6
Lsi02g00880 . 42 307 Chloroplast and Mitochondria Gene Families AT1G29930 85.8 2.1e-131 465.3
Lsi03g01151 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29930 84.5 1.2e-126 449.5
Lsi02g00879 . 1 246 Chloroplast and Mitochondria Gene Families AT1G29930 82.0 1.6e-123 439.1
Lsi11g01355 . 52 314 Chloroplast and Mitochondria Gene Families AT1G29930 78.3 3.3e-116 414.8
Lsi05g00685 . 11 264 Chloroplast and Mitochondria Gene Families AT1G29930 67.5 3.5e-94 341.7
Lsi02g00878 . 4 167 Chloroplast and Mitochondria Gene Families AT1G29930 84.8 8.7e-77 283.9
Lsi10g01537 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 88.1 1.7e-136 482.3
Lsi01g00172 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.0 4.1e-135 477.6
Lsi01g00173 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.0 4.1e-135 477.6
Lsi02g00880 . 42 307 Chloroplast and Mitochondria Gene Families AT1G29920 85.4 8.0e-131 463.4
Lsi03g01151 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29920 84.5 1.6e-126 449.1
Lsi02g00879 . 1 246 Chloroplast and Mitochondria Gene Families AT1G29920 81.6 6.1e-123 437.2
Lsi11g01355 . 52 314 Chloroplast and Mitochondria Gene Families AT1G29920 77.9 1.9e-116 415.6
Lsi05g00685 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29920 69.8 3.5e-94 341.7
Lsi02g00878 . 4 167 Chloroplast and Mitochondria Gene Families AT1G29920 84.2 3.3e-76 282.0
Lsi10g01537 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 88.1 1.7e-136 482.3
Lsi01g00172 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.0 4.1e-135 477.6
Lsi01g00173 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.0 4.1e-135 477.6
Lsi02g00880 . 42 307 Chloroplast and Mitochondria Gene Families AT1G29910 85.4 8.0e-131 463.4
Lsi03g01151 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29910 84.5 1.6e-126 449.1
Lsi02g00879 . 1 246 Chloroplast and Mitochondria Gene Families AT1G29910 81.6 6.1e-123 437.2
Lsi11g01355 . 52 314 Chloroplast and Mitochondria Gene Families AT1G29910 77.9 1.9e-116 415.6
Lsi05g00685 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29910 69.8 3.5e-94 341.7
Lsi02g00878 . 4 167 Chloroplast and Mitochondria Gene Families AT1G29910 84.2 3.3e-76 282.0
Lsi08g00191 . 11 275 Chloroplast and Mitochondria Gene Families AT4G10340 80.1 1.5e-127 452.6
Lsi02g00880 . 82 295 Chloroplast and Mitochondria Gene Families AT4G10340 53.6 2.1e-57 219.5
Lsi01g00172 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 6.1e-57 218.0
Lsi01g00173 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 6.1e-57 218.0
Lsi10g01537 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 8.0e-57 217.6
Lsi03g01151 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 53.6 2.3e-56 216.1
Lsi11g01355 . 98 302 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 2.9e-54 209.1
Lsi05g00685 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 2.7e-52 202.6
Lsi10g01537 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 2.8e-136 481.5
Lsi01g00172 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 4.5e-134 474.2
Lsi01g00173 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 4.5e-134 474.2
Lsi02g00880 . 42 307 Chloroplast and Mitochondria Gene Families AT2G34420 85.4 3.9e-130 461.1
Lsi03g01151 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34420 84.9 2.4e-127 451.8
Lsi02g00879 . 1 246 Chloroplast and Mitochondria Gene Families AT2G34420 80.9 9.7e-121 429.9
Lsi11g01355 . 52 314 Chloroplast and Mitochondria Gene Families AT2G34420 77.2 6.5e-117 417.2
Lsi05g00685 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34420 70.2 3.5e-94 341.7
Lsi02g00878 . 4 167 Chloroplast and Mitochondria Gene Families AT2G34420 84.2 2.1e-75 279.3
Lsi01g00172 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 1.3e-136 482.6
Lsi01g00173 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 1.3e-136 482.6
Lsi10g01537 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 87.7 3.1e-135 478.0
Lsi02g00880 . 42 307 Chloroplast and Mitochondria Gene Families AT2G34430 86.1 1.7e-133 472.2
Lsi03g01151 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34430 85.2 3.4e-129 458.0
Lsi02g00879 . 1 246 Chloroplast and Mitochondria Gene Families AT2G34430 81.2 1.6e-123 439.1
Lsi11g01355 . 80 314 Chloroplast and Mitochondria Gene Families AT2G34430 83.2 1.8e-114 409.1
Lsi05g00685 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34430 71.0 3.5e-94 341.7
Lsi02g00878 . 4 167 Chloroplast and Mitochondria Gene Families AT2G34430 84.1 4.6e-78 288.1
Lsi03g02207 . 2 280 Chloroplast and Mitochondria Gene Families AT5G01530 86.8 1.6e-140 495.7
Lsi01g01533 . 2 284 Chloroplast and Mitochondria Gene Families AT5G01530 83.8 3.6e-137 484.6
Lsi05g00793 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 94.2 2.8e-144 508.1
Lsi05g00793 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 85.4 2.6e-149 525.0
Lsi10g01460 . 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 75.6 3.5e-144 508.1
Lsi01g01574 . 9 311 Chloroplast and Mitochondria Gene Families AT2G30160 63.9 1.1e-110 396.7
Lsi10g01460 . 5 327 Chloroplast and Mitochondria Gene Families AT1G07030 76.1 2.2e-143 505.4
Lsi01g01574 . 5 311 Chloroplast and Mitochondria Gene Families AT1G07030 67.2 9.5e-118 420.2
Lsi02g02438 . 1 345 Chloroplast and Mitochondria Gene Families AT2G47490 68.2 3.9e-129 458.0
Lsi02g02438 . 11 332 Chloroplast and Mitochondria Gene Families AT1G25380 57.3 5.3e-101 364.8
Lsi02g00703 . 668 1218 Chloroplast and Mitochondria Gene Families AT4G21490 74.6 2.6e-243 838.2
Lsi10g00864 . 489 1044 Chloroplast and Mitochondria Gene Families AT4G21490 71.1 1.4e-233 805.8
Lsi11g01519 . 1 577 Chloroplast and Mitochondria Gene Families AT4G21490 64.7 7.1e-225 776.9
Lsi02g02919 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 65.4 1.1e-62 236.5
Lsi06g00803 . 4 179 Chloroplast and Mitochondria Gene Families AT1G17530 59.0 1.9e-51 199.1
Lsi06g00803 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 59.0 2.0e-51 199.1
Lsi02g02919 . 22 190 Chloroplast and Mitochondria Gene Families AT3G04800 55.0 8.9e-44 173.7
Lsi02g02919 . 15 190 Chloroplast and Mitochondria Gene Families AT1G72750 69.6 5.4e-65 244.2
Lsi06g00803 . 5 183 Chloroplast and Mitochondria Gene Families AT1G72750 58.8 3.6e-53 204.9
Lsi04g00298 CCT 615 854 Chloroplast and Mitochondria Gene Families AT1G26100 57.9 5.9e-69 257.7
Lsi03g00225 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 70.5 1.0e-89 326.6
Lsi05g00005 . 23 218 Chloroplast and Mitochondria Gene Families AT4G25570 73.0 8.5e-83 303.9
Lsi09g00711 . 2 219 Chloroplast and Mitochondria Gene Families AT1G14730 52.8 4.9e-65 244.6
Lsi09g00822 . 9 370 Chloroplast and Mitochondria Gene Families AT5G14040 77.1 4.4e-159 557.8
Lsi06g01674 . 37 338 Chloroplast and Mitochondria Gene Families AT5G14040 86.1 2.5e-154 542.0
Lsi11g01295 . 31 312 Chloroplast and Mitochondria Gene Families AT5G14040 51.4 6.3e-81 298.1
Lsi05g00457 . 49 235 Chloroplast and Mitochondria Gene Families AT5G14040 64.2 1.5e-79 293.5
Lsi06g01674 . 32 338 Chloroplast and Mitochondria Gene Families AT3G48850 74.9 3.7e-139 491.5
Lsi09g00822 . 8 362 Chloroplast and Mitochondria Gene Families AT3G48850 68.1 4.7e-134 474.6
Lsi11g01295 . 31 312 Chloroplast and Mitochondria Gene Families AT3G48850 50.3 7.1e-82 301.2
Lsi05g00457 . 49 235 Chloroplast and Mitochondria Gene Families AT3G48850 62.1 5.0e-75 278.5
Lsi11g01295 . 34 311 Chloroplast and Mitochondria Gene Families AT2G17270 78.4 3.3e-128 454.9
Lsi03g00181 . 18 310 Chloroplast and Mitochondria Gene Families AT5G15640 77.0 1.3e-127 453.0
Lsi04g01400 . 12 345 Chloroplast and Mitochondria Gene Families AT5G26200 67.7 1.7e-125 446.0
Lsi02g02914 . 10 353 Chloroplast and Mitochondria Gene Families AT5G26200 58.7 1.0e-106 383.6
Lsi02g02914 . 10 357 Chloroplast and Mitochondria Gene Families AT1G72820 76.6 1.0e-149 526.6
Lsi04g01400 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 68.2 1.5e-129 459.5
Lsi05g01196 . 1 223 Chloroplast and Mitochondria Gene Families AT4G25700 62.6 1.1e-69 260.0
Lsi09g00227 . 28 187 Chloroplast and Mitochondria Gene Families AT4G25700 53.5 6.7e-46 181.0
Lsi11g01501 . 123 301 Chloroplast and Mitochondria Gene Families AT4G03320 51.7 3.1e-56 215.7
Lsi05g00688 . 62 386 Chloroplast and Mitochondria Gene Families AT5G54290 70.6 4.8e-115 411.4
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0001660 3 2 4 3 4 2 3 2 2 2 2 2 4 2 2 4 2 1 4 2 2 2 2 2 2 2 1 2 2 1 70
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Lsi01g01574 Lsi_Chr01 FPKM 32.084465 35.183289 32.086891 33.145973 32.786182 27.397951 29.672382 43.87035 45.409897 46.152905