Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Lsi01g01659 ATGAACGACTTGATGACCAAATCGTTCACCAGCTATGTGGATCTGAAGAAGGCAGCCATGAAAGATCTCGATCTCGAAGCCGGTTTAGAAATGCCATCGTCCGTTGCCGGCGACAACGGCGACATGGGTCTTTTTCTCGAAGAAGCCGAGAAGGTGAAAATGGAGATGGGTTCAATTAGAGAGATTTTACTTAAACTCCAACAAGCTAACGAAGAGACCAAATCTGCTCACAAACCCGAAACTCTCAAATCGCTTCGTAATACAATCAACGTCGACATCGTCACCGTTCTGAAAAAGGCGCGATCGATCCGATCTCAGCTCGAGGAAATGGACCGCGCCAACGCTGCAAAAAAACGTCTCTCTGGCAGCAAAGAAGGCACTGCCATTTACCGGACGAGAATCGCAGTGACGAACGGGCTACGAAAGAAGCTAAAGGAATTAATGATGGAGTTTCAAAGCTTGAGGCAGAGGATGATGACGGAGTACAAGGAAACGGTCGGGCGACGGTACTTCACGGTGACGGGGGAGCATCCGGAGGAGGAGGTGATAGAGAAGATAATATCGAATGGAGGGGAGGAGTTTTTGGGGAGGGCGATAGAGGAGCACGGGAGAGGGAAGGTAGCGGAGACGGTGGTGGAGATACAAGACCGACACGGGGCGGCGAAGGAGATAGAGAAGAGTTTGTTAGAGCTACATCAAGTGTTTTTGGATATGGCAGTGATGGTTGAAGCACAAGGGGAAAAAATGGATGATATTGAACATCATGTGATGAATGCTTCACAATATGTGAGAGATGGGACTAAGGATTTGAAGACTGCAAAAGATTTGCAAAAGAACAGTAGAAAGTGTATGTGTTTTGGGATTTTGCTTTTGCTTTTGATTATTTTGGTTGTTGTTATTCCTATTGCTGTTAGTTTTGGAAGTTCTTGA 930 46.45 MNDLMTKSFTSYVDLKKAAMKDLDLEAGLEMPSSVAGDNGDMGLFLEEAEKVKMEMGSIREILLKLQQANEETKSAHKPETLKSLRNTINVDIVTVLKKARSIRSQLEEMDRANAAKKRLSGSKEGTAIYRTRIAVTNGLRKKLKELMMEFQSLRQRMMTEYKETVGRRYFTVTGEHPEEEVIEKIISNGGEEFLGRAIEEHGRGKVAETVVEIQDRHGAAKEIEKSLLELHQVFLDMAVMVEAQGEKMDDIEHHVMNASQYVRDGTKDLKTAKDLQKNSRKCMCFGILLLLLIILVVVIPIAVSFGSS 309
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
1 15160644 15161782 + Lsi01G016590.1 Lsi01g01659 654317

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Lsi01g01659 309 SMART tSNARE_6 206 273 IPR000727 -
Lsi01g01659 309 CDD SNARE_syntaxin1-like 210 272 - -
Lsi01g01659 309 PANTHER SYNTAXIN 4 302 IPR045242 -
Lsi01g01659 309 Gene3D - 206 307 - -
Lsi01g01659 309 SUPERFAMILY t-snare proteins 41 266 IPR010989 GO:0016020|GO:0016192
Lsi01g01659 309 ProSitePatterns Syntaxin / epimorphin family signature. 217 257 IPR006012 GO:0005484|GO:0006886|GO:0016020
Lsi01g01659 309 Gene3D - 38 166 - -
Lsi01g01659 309 CDD SynN 42 198 IPR006011 GO:0016020
Lsi01g01659 309 Pfam Syntaxin 45 246 IPR006011 GO:0016020
Lsi01g01659 309 PANTHER SYNTAXIN-RELATED PROTEIN KNOLLE 4 302 - -
Lsi01g01659 309 Pfam SNARE domain 248 299 IPR000727 -
Lsi01g01659 309 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 211 273 IPR000727 -
Lsi01g01659 309 SMART SynN_4 37 163 IPR006011 GO:0016020
Lsi01g01659 309 Coils Coil 137 157 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lsi01g01659 K08486 STX1B_2_3; syntaxin 1B/2/3 - csv:101220775 558.525
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Lsi01g01659 Lsi-Chr1:15160644 Lsi02g00706 Lsi-Chr2:6322594 1.05E-98 dispersed
Lsi01g01659 Lsi-Chr1:15160644 Lsi01g01181 Lsi-Chr1:10035743 2.50E-78 transposed
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi8g156 . . . . . . . . . . Cma03g00248 . Car03g00212 . Sed14g0695 Cpe10g01038 Cpe08g00962 Bhi03g02299 Tan03g0640 Cmetu08g0109 . Hepe04g0635 . . . . . . . . . Cone3ag0557 Cone10ag0552 Cone13ag0475 . Lsi01g01659 Csa04g01137 . Cme04g01796 . . . . . . . . . Cmo03g00262 Cmo07g01220 . . . . . . Bhi11g01551 . . . . . . . . . . . . . . . . Cme08g02007
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lsi08g01147 . 8 338 SNARE and Associated Proteins AT3G24350 65.1 4.7e-102 368.2
Lsi01g01659 . 1 309 SNARE and Associated Proteins AT1G08560 69.0 1.0e-100 363.6
Lsi01g00668 . 428 710 SNARE and Associated Proteins AT2G18260 55.2 2.3e-81 299.3
Lsi03g01810 . 19 254 SNARE and Associated Proteins AT3G11820 80.5 1.4e-102 369.8
Lsi01g01181 . 26 282 SNARE and Associated Proteins AT3G11820 73.2 2.4e-102 369.0
Lsi02g00706 . 31 281 SNARE and Associated Proteins AT3G11820 66.9 7.8e-93 337.4
Lsi03g01319 . 12 236 SNARE and Associated Proteins AT3G11820 55.6 1.7e-63 240.0
Lsi01g01181 . 33 282 SNARE and Associated Proteins AT3G52400 65.2 6.5e-85 311.2
Lsi03g01810 . 1 255 SNARE and Associated Proteins AT3G52400 63.7 3.0e-82 302.4
Lsi02g00706 . 1 281 SNARE and Associated Proteins AT3G52400 56.7 1.5e-81 300.1
Lsi03g01319 . 11 236 SNARE and Associated Proteins AT3G52400 52.7 3.7e-56 215.7
Lsi02g00706 . 1 299 SNARE and Associated Proteins AT4G03330 68.5 2.4e-107 385.6
Lsi01g01181 . 1 298 SNARE and Associated Proteins AT4G03330 51.5 9.0e-78 287.3
Lsi03g01810 . 1 253 SNARE and Associated Proteins AT4G03330 59.1 2.9e-76 282.3
Lsi03g01319 . 10 236 SNARE and Associated Proteins AT4G03330 57.3 3.3e-64 242.3
Lsi02g00706 . 1 299 SNARE and Associated Proteins AT1G61290 78.6 4.7e-127 451.1
Lsi01g01181 . 1 293 SNARE and Associated Proteins AT1G61290 56.3 7.5e-85 310.8
Lsi03g01810 . 1 254 SNARE and Associated Proteins AT1G61290 63.8 7.1e-83 304.3
Lsi03g01319 . 10 236 SNARE and Associated Proteins AT1G61290 52.9 2.9e-60 229.2
Lsi02g00706 . 1 299 SNARE and Associated Proteins AT1G11250 77.6 4.7e-124 441.0
Lsi01g01181 . 1 293 SNARE and Associated Proteins AT1G11250 57.0 6.1e-87 317.8
Lsi03g01810 . 1 254 SNARE and Associated Proteins AT1G11250 63.0 9.7e-85 310.5
Lsi03g01319 . 12 236 SNARE and Associated Proteins AT1G11250 54.7 2.3e-62 236.1
Lsi03g01319 . 12 259 SNARE and Associated Proteins AT3G03800 76.6 5.4e-99 357.8
Lsi03g01319 . 12 154 SNARE and Associated Proteins AT5G08080 83.2 1.2e-60 229.9
Lsi07g01177 . 1 272 SNARE and Associated Proteins AT5G16830 56.5 8.0e-73 270.8
Lsi07g01177 . 1 272 SNARE and Associated Proteins AT5G46860 62.5 1.3e-77 286.6
Lsi07g01177 . 1 190 SNARE and Associated Proteins AT4G17730 76.4 1.7e-72 269.6
Lsi07g01177 . 65 272 SNARE and Associated Proteins AT1G32270 55.3 1.4e-50 197.2
Lsi04g00969 . 1 286 SNARE and Associated Proteins AT5G05760 64.5 6.6e-90 327.8
Lsi08g01147 . 8 338 SNARE and Associated Proteins AT3G24350 65.1 4.7e-102 368.2
Lsi11g00612 . 1 327 SNARE and Associated Proteins AT5G26980 75.8 1.1e-126 449.9
Lsi02g02441 . 1 286 SNARE and Associated Proteins AT5G26980 64.8 2.7e-88 322.4
Lsi11g00612 . 1 329 SNARE and Associated Proteins AT4G02195 64.7 3.7e-106 381.7
Lsi02g02441 . 1 286 SNARE and Associated Proteins AT4G02195 66.9 3.6e-93 338.6
Lsi11g00612 . 1 328 SNARE and Associated Proteins AT3G05710 75.4 9.3e-129 456.8
Lsi02g02441 . 1 286 SNARE and Associated Proteins AT3G05710 62.5 2.8e-85 312.4
Lsi02g01877 . 1 225 SNARE and Associated Proteins AT1G16240 69.5 2.4e-83 305.4
Lsi05g00543 . 23 286 SNARE and Associated Proteins AT1G16240 57.6 7.1e-75 277.3
Lsi02g01877 . 1 225 SNARE and Associated Proteins AT1G79590 68.7 2.3e-82 302.4
Lsi05g00543 . 23 286 SNARE and Associated Proteins AT1G79590 58.3 4.3e-76 281.6
Lsi09g01890 . 38 229 SNARE and Associated Proteins AT1G28490 72.9 3.2e-68 255.0
Lsi03g02035 . 38 327 SNARE and Associated Proteins AT3G09740 72.6 5.0e-109 391.0
Lsi10g01278 . 1 254 SNARE and Associated Proteins AT3G09740 60.7 4.9e-80 294.7
Lsi03g02035 . 38 327 SNARE and Associated Proteins AT3G45280 58.7 1.6e-83 306.2
Lsi10g01278 . 1 254 SNARE and Associated Proteins AT3G45280 57.7 1.4e-74 276.6
Lsi03g02035 . 38 324 SNARE and Associated Proteins AT3G61450 62.1 1.4e-90 329.7
Lsi10g01278 . 1 251 SNARE and Associated Proteins AT3G61450 54.9 2.4e-71 265.8
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0010730 0 1 0 0 0 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 1 1 1 2 1 1 32
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Lsi01g01659 Lsi_Chr01 FPKM 4.231683 3.699669 5.431423 4.095852 9.89642 9.563557 10.162329 7.531049 7.036335 6.697162