Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Lsi03g01319 ATGATGTTGCTTTATTTCCAAGCTGCAAGAAACCTTAGCGATTCACATGAGGAGTCCAAAGCTGTGACTAAAGCTCCAGCAATGAAAGCAATCAAGCAGCGAATGGAAAAAGATGTCGATGAAGTTGGAAAAGTTGCACGTTTTGTGAAGACCAAAGTTGAAGAACTCGACAGAGAGAATCTGGCAAATAGGCAGAGGCCCGGGTGTGGAAAAGGATCAGGTGTAGATAGATCAAGAACTGCAACTACTCTTTCCTTAAAAAAGAAGTTAAAAGACAAGATGACTGAATTCCAGATTTTACGGGAAAAAATCCATCAAGAGTACCGGGAAGTTGTTGAGAGACGAGTTTTCACAGTCACGGGTGCTAGGGCTGACGAAGAGACCATCGAGAAATTAATTGAAACTGGGGATAGTGAACAAATTTTTCAGAAGGCAATTCAAGAACAAGGGCGAGGACAGGTAATGGACACTCTAGCTGAAATTCAAGAGCGTCACAGTGCAGTTAGAGAACTGGAGAGGAAGTTACTCGAGCTACAGCAGGTATTTCTCGACATGGCAGTATTGGTGGATGCACAAGGGGATATGCTCGACAATATCGAATCACATGTTACAAGTGCAGTAGATCATGTGCAACAAGGGAATACTGCTCTTCAAAAGGCAAAGAAGCTGCAAAAGAATTCTAGGAAATGGATGTGCATGGCCATCATAATCCTTCTAATCATTGTTGTGGTCATAGTAGTGGGAGTCCTTAAGCCATGGAATAATGCATGTGGTGGAGAAATATTTGGTCCTTTACATGTTATAAGTGCTAAAGAGCTTGAATGA 825 42.06 MMLLYFQAARNLSDSHEESKAVTKAPAMKAIKQRMEKDVDEVGKVARFVKTKVEELDRENLANRQRPGCGKGSGVDRSRTATTLSLKKKLKDKMTEFQILREKIHQEYREVVERRVFTVTGARADEETIEKLIETGDSEQIFQKAIQEQGRGQVMDTLAEIQERHSAVRELERKLLELQQVFLDMAVLVDAQGDMLDNIESHVTSAVDHVQQGNTALQKAKKLQKNSRKWMCMAIIILLIIVVVIVVGVLKPWNNACGGEIFGPLHVISAKELE 274
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
3 23988017 23997598 - Lsi03G013190.1 Lsi03g01319 659069

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Lsi03g01319 274 CDD SynN 1 145 IPR006011 GO:0016020
Lsi03g01319 274 SMART SynN_4 1 109 IPR006011 GO:0016020
Lsi03g01319 274 Gene3D - 7 116 - -
Lsi03g01319 274 SUPERFAMILY t-snare proteins 20 213 IPR010989 GO:0016020|GO:0016192
Lsi03g01319 274 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 158 220 IPR000727 -
Lsi03g01319 274 ProSitePatterns Syntaxin / epimorphin family signature. 164 203 IPR006012 GO:0005484|GO:0006886|GO:0016020
Lsi03g01319 274 PANTHER - 10 251 - -
Lsi03g01319 274 PANTHER SYNTAXIN 10 251 IPR045242 -
Lsi03g01319 274 SMART tSNARE_6 153 220 IPR000727 -
Lsi03g01319 274 Pfam SNARE domain 194 246 IPR000727 -
Lsi03g01319 274 Gene3D - 147 251 - -
Lsi03g01319 274 Coils Coil 161 181 - -
Lsi03g01319 274 Pfam Syntaxin 9 193 IPR006011 GO:0016020
Lsi03g01319 274 CDD SNARE_syntaxin1-like 157 219 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lsi03g01319 K08486 STX1B_2_3; syntaxin 1B/2/3 - csv:101203075 420.239
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Lsi03g01319 Lsi-Chr3:23988017 Lsi10g00145 Lsi-Chr10:2351402 1.11E-09 dispersed
Lsi03g01319 Lsi-Chr3:23988017 Lsi01g01181 Lsi-Chr1:10035743 2.13E-82 transposed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lsi08g01147 . 8 338 SNARE and Associated Proteins AT3G24350 65.1 4.7e-102 368.2
Lsi01g01659 . 1 309 SNARE and Associated Proteins AT1G08560 69.0 1.0e-100 363.6
Lsi01g00668 . 428 710 SNARE and Associated Proteins AT2G18260 55.2 2.3e-81 299.3
Lsi03g01810 . 19 254 SNARE and Associated Proteins AT3G11820 80.5 1.4e-102 369.8
Lsi01g01181 . 26 282 SNARE and Associated Proteins AT3G11820 73.2 2.4e-102 369.0
Lsi02g00706 . 31 281 SNARE and Associated Proteins AT3G11820 66.9 7.8e-93 337.4
Lsi03g01319 . 12 236 SNARE and Associated Proteins AT3G11820 55.6 1.7e-63 240.0
Lsi01g01181 . 33 282 SNARE and Associated Proteins AT3G52400 65.2 6.5e-85 311.2
Lsi03g01810 . 1 255 SNARE and Associated Proteins AT3G52400 63.7 3.0e-82 302.4
Lsi02g00706 . 1 281 SNARE and Associated Proteins AT3G52400 56.7 1.5e-81 300.1
Lsi03g01319 . 11 236 SNARE and Associated Proteins AT3G52400 52.7 3.7e-56 215.7
Lsi02g00706 . 1 299 SNARE and Associated Proteins AT4G03330 68.5 2.4e-107 385.6
Lsi01g01181 . 1 298 SNARE and Associated Proteins AT4G03330 51.5 9.0e-78 287.3
Lsi03g01810 . 1 253 SNARE and Associated Proteins AT4G03330 59.1 2.9e-76 282.3
Lsi03g01319 . 10 236 SNARE and Associated Proteins AT4G03330 57.3 3.3e-64 242.3
Lsi02g00706 . 1 299 SNARE and Associated Proteins AT1G61290 78.6 4.7e-127 451.1
Lsi01g01181 . 1 293 SNARE and Associated Proteins AT1G61290 56.3 7.5e-85 310.8
Lsi03g01810 . 1 254 SNARE and Associated Proteins AT1G61290 63.8 7.1e-83 304.3
Lsi03g01319 . 10 236 SNARE and Associated Proteins AT1G61290 52.9 2.9e-60 229.2
Lsi02g00706 . 1 299 SNARE and Associated Proteins AT1G11250 77.6 4.7e-124 441.0
Lsi01g01181 . 1 293 SNARE and Associated Proteins AT1G11250 57.0 6.1e-87 317.8
Lsi03g01810 . 1 254 SNARE and Associated Proteins AT1G11250 63.0 9.7e-85 310.5
Lsi03g01319 . 12 236 SNARE and Associated Proteins AT1G11250 54.7 2.3e-62 236.1
Lsi03g01319 . 12 259 SNARE and Associated Proteins AT3G03800 76.6 5.4e-99 357.8
Lsi03g01319 . 12 154 SNARE and Associated Proteins AT5G08080 83.2 1.2e-60 229.9
Lsi07g01177 . 1 272 SNARE and Associated Proteins AT5G16830 56.5 8.0e-73 270.8
Lsi07g01177 . 1 272 SNARE and Associated Proteins AT5G46860 62.5 1.3e-77 286.6
Lsi07g01177 . 1 190 SNARE and Associated Proteins AT4G17730 76.4 1.7e-72 269.6
Lsi07g01177 . 65 272 SNARE and Associated Proteins AT1G32270 55.3 1.4e-50 197.2
Lsi04g00969 . 1 286 SNARE and Associated Proteins AT5G05760 64.5 6.6e-90 327.8
Lsi08g01147 . 8 338 SNARE and Associated Proteins AT3G24350 65.1 4.7e-102 368.2
Lsi11g00612 . 1 327 SNARE and Associated Proteins AT5G26980 75.8 1.1e-126 449.9
Lsi02g02441 . 1 286 SNARE and Associated Proteins AT5G26980 64.8 2.7e-88 322.4
Lsi11g00612 . 1 329 SNARE and Associated Proteins AT4G02195 64.7 3.7e-106 381.7
Lsi02g02441 . 1 286 SNARE and Associated Proteins AT4G02195 66.9 3.6e-93 338.6
Lsi11g00612 . 1 328 SNARE and Associated Proteins AT3G05710 75.4 9.3e-129 456.8
Lsi02g02441 . 1 286 SNARE and Associated Proteins AT3G05710 62.5 2.8e-85 312.4
Lsi02g01877 . 1 225 SNARE and Associated Proteins AT1G16240 69.5 2.4e-83 305.4
Lsi05g00543 . 23 286 SNARE and Associated Proteins AT1G16240 57.6 7.1e-75 277.3
Lsi02g01877 . 1 225 SNARE and Associated Proteins AT1G79590 68.7 2.3e-82 302.4
Lsi05g00543 . 23 286 SNARE and Associated Proteins AT1G79590 58.3 4.3e-76 281.6
Lsi09g01890 . 38 229 SNARE and Associated Proteins AT1G28490 72.9 3.2e-68 255.0
Lsi03g02035 . 38 327 SNARE and Associated Proteins AT3G09740 72.6 5.0e-109 391.0
Lsi10g01278 . 1 254 SNARE and Associated Proteins AT3G09740 60.7 4.9e-80 294.7
Lsi03g02035 . 38 327 SNARE and Associated Proteins AT3G45280 58.7 1.6e-83 306.2
Lsi10g01278 . 1 254 SNARE and Associated Proteins AT3G45280 57.7 1.4e-74 276.6
Lsi03g02035 . 38 324 SNARE and Associated Proteins AT3G61450 62.1 1.4e-90 329.7
Lsi10g01278 . 1 251 SNARE and Associated Proteins AT3G61450 54.9 2.4e-71 265.8
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0001189 1 6 1 1 1 2 3 2 2 2 2 2 3 2 3 3 2 4 3 2 3 1 2 3 3 2 3 8 3 2 77
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Lsi03g01319 Lsi_Chr03 FPKM 5.143939 6.811493 2.090175 1.751726 0.264572 0.633217 0.449639 0.211549 0.438278 0.283292