Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Lsi05g00543 ATGGAGATGAGAGTTCAATTTGCTGTTATTAATGCGTCTCTGCTTGTCAGGTTGGTGATGGCACCTTCTGATTTATGGATAAAGGAATATAATGAAGCCTCTAAGCTTGGTGATGATATCAATAGCATGATTTCTGAAAGGAGTTCCTTTCCTGCATCTGGACCAGAATCTCAACGTCATGCCTCTGCCATTCGGAGGAAGATCACAATTTTGGGGACTAAAGTTGATGGCTTACAGTCCCTTTTGTTGAAGCTTCCTGTAAAGCAGCCCCTGTATGAAAAGGAGATAAATCGACGTAAAGACATGCTTGCTCAGATGAGATCTAAAGTAAAGCAGATGGCCTCAAGTTTGAACATGTCAAACTTTGCTAACCGAGACAGTTTGCTCGGCCCAGATACAAAATCGGCGGATGTAATGAGCAAGACAGCTGGACTAGACAATCAAGGACTTGTTGGTTTTCAAAGACAAATCATGAAGGAGCAAGATGAAGGTCTTGAAAAGCTGGAGGAGACTATTATAAGTACAAAACATATTGCATTAGCAGTTAATGAAGAACTCAATCTTCACACTCGCCTAATTGATGACCTGGACCAGCATGTCGATGTTACAGACTCGAGATTAGCGATATCTTTAGGATGTAGAGATAATTTATCACTAGTTGAAGTTAGATGTGGTAAATTCGTCTGTATATATACATCAAGGTTGTTCCTGACCTTGAATGAACAGCAGAGGGTGCAGAAGAGATTGGGAATATTGAACAAGCGAGCAAAGGAGAGCTGCTCTTGCTTTGGAATGCTTCTGTCTGTGGTTGGTATTGTGGTTCTCATTGCTGTCATATGGCTGCTCATTCGATACTTGTAA 861 41.23 MEMRVQFAVINASLLVRLVMAPSDLWIKEYNEASKLGDDINSMISERSSFPASGPESQRHASAIRRKITILGTKVDGLQSLLLKLPVKQPLYEKEINRRKDMLAQMRSKVKQMASSLNMSNFANRDSLLGPDTKSADVMSKTAGLDNQGLVGFQRQIMKEQDEGLEKLEETIISTKHIALAVNEELNLHTRLIDDLDQHVDVTDSRLAISLGCRDNLSLVEVRCGKFVCIYTSRLFLTLNEQQRVQKRLGILNKRAKESCSCFGMLLSVVGIVVLIAVIWLLIRYL 286
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
5 6752568 6754952 + Lsi05G005430.1 Lsi05g00543 663035

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Lsi05g00543 286 PANTHER TARGET SNARE COILED-COIL DOMAIN-CONTAINING PROTEIN-RELATED 241 281 - -
Lsi05g00543 286 PANTHER TARGET SNARE COILED-COIL DOMAIN-CONTAINING PROTEIN-RELATED 20 208 - -
Lsi05g00543 286 CDD SNARE_Qc 158 207 - -
Lsi05g00543 286 Gene3D - 157 211 - -
Lsi05g00543 286 PANTHER SYNTAXIN 241 281 IPR045242 -
Lsi05g00543 286 PANTHER SYNTAXIN 20 208 IPR045242 -
Lsi05g00543 286 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 155 207 IPR000727 -
Lsi05g00543 286 SUPERFAMILY SNARE fusion complex 146 208 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lsi05g00543 K08503 SYP5; syntaxin of plants SYP5 - csv:101223140 390.963
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Lsi02g01877 Lsi-Chr2:24587361 Lsi05g00543 Lsi-Chr5:6752568 1.08E-116 wgd
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lsi08g01147 . 8 338 SNARE and Associated Proteins AT3G24350 65.1 4.7e-102 368.2
Lsi01g01659 . 1 309 SNARE and Associated Proteins AT1G08560 69.0 1.0e-100 363.6
Lsi01g00668 . 428 710 SNARE and Associated Proteins AT2G18260 55.2 2.3e-81 299.3
Lsi03g01810 . 19 254 SNARE and Associated Proteins AT3G11820 80.5 1.4e-102 369.8
Lsi01g01181 . 26 282 SNARE and Associated Proteins AT3G11820 73.2 2.4e-102 369.0
Lsi02g00706 . 31 281 SNARE and Associated Proteins AT3G11820 66.9 7.8e-93 337.4
Lsi03g01319 . 12 236 SNARE and Associated Proteins AT3G11820 55.6 1.7e-63 240.0
Lsi01g01181 . 33 282 SNARE and Associated Proteins AT3G52400 65.2 6.5e-85 311.2
Lsi03g01810 . 1 255 SNARE and Associated Proteins AT3G52400 63.7 3.0e-82 302.4
Lsi02g00706 . 1 281 SNARE and Associated Proteins AT3G52400 56.7 1.5e-81 300.1
Lsi03g01319 . 11 236 SNARE and Associated Proteins AT3G52400 52.7 3.7e-56 215.7
Lsi02g00706 . 1 299 SNARE and Associated Proteins AT4G03330 68.5 2.4e-107 385.6
Lsi01g01181 . 1 298 SNARE and Associated Proteins AT4G03330 51.5 9.0e-78 287.3
Lsi03g01810 . 1 253 SNARE and Associated Proteins AT4G03330 59.1 2.9e-76 282.3
Lsi03g01319 . 10 236 SNARE and Associated Proteins AT4G03330 57.3 3.3e-64 242.3
Lsi02g00706 . 1 299 SNARE and Associated Proteins AT1G61290 78.6 4.7e-127 451.1
Lsi01g01181 . 1 293 SNARE and Associated Proteins AT1G61290 56.3 7.5e-85 310.8
Lsi03g01810 . 1 254 SNARE and Associated Proteins AT1G61290 63.8 7.1e-83 304.3
Lsi03g01319 . 10 236 SNARE and Associated Proteins AT1G61290 52.9 2.9e-60 229.2
Lsi02g00706 . 1 299 SNARE and Associated Proteins AT1G11250 77.6 4.7e-124 441.0
Lsi01g01181 . 1 293 SNARE and Associated Proteins AT1G11250 57.0 6.1e-87 317.8
Lsi03g01810 . 1 254 SNARE and Associated Proteins AT1G11250 63.0 9.7e-85 310.5
Lsi03g01319 . 12 236 SNARE and Associated Proteins AT1G11250 54.7 2.3e-62 236.1
Lsi03g01319 . 12 259 SNARE and Associated Proteins AT3G03800 76.6 5.4e-99 357.8
Lsi03g01319 . 12 154 SNARE and Associated Proteins AT5G08080 83.2 1.2e-60 229.9
Lsi07g01177 . 1 272 SNARE and Associated Proteins AT5G16830 56.5 8.0e-73 270.8
Lsi07g01177 . 1 272 SNARE and Associated Proteins AT5G46860 62.5 1.3e-77 286.6
Lsi07g01177 . 1 190 SNARE and Associated Proteins AT4G17730 76.4 1.7e-72 269.6
Lsi07g01177 . 65 272 SNARE and Associated Proteins AT1G32270 55.3 1.4e-50 197.2
Lsi04g00969 . 1 286 SNARE and Associated Proteins AT5G05760 64.5 6.6e-90 327.8
Lsi08g01147 . 8 338 SNARE and Associated Proteins AT3G24350 65.1 4.7e-102 368.2
Lsi11g00612 . 1 327 SNARE and Associated Proteins AT5G26980 75.8 1.1e-126 449.9
Lsi02g02441 . 1 286 SNARE and Associated Proteins AT5G26980 64.8 2.7e-88 322.4
Lsi11g00612 . 1 329 SNARE and Associated Proteins AT4G02195 64.7 3.7e-106 381.7
Lsi02g02441 . 1 286 SNARE and Associated Proteins AT4G02195 66.9 3.6e-93 338.6
Lsi11g00612 . 1 328 SNARE and Associated Proteins AT3G05710 75.4 9.3e-129 456.8
Lsi02g02441 . 1 286 SNARE and Associated Proteins AT3G05710 62.5 2.8e-85 312.4
Lsi02g01877 . 1 225 SNARE and Associated Proteins AT1G16240 69.5 2.4e-83 305.4
Lsi05g00543 . 23 286 SNARE and Associated Proteins AT1G16240 57.6 7.1e-75 277.3
Lsi02g01877 . 1 225 SNARE and Associated Proteins AT1G79590 68.7 2.3e-82 302.4
Lsi05g00543 . 23 286 SNARE and Associated Proteins AT1G79590 58.3 4.3e-76 281.6
Lsi09g01890 . 38 229 SNARE and Associated Proteins AT1G28490 72.9 3.2e-68 255.0
Lsi03g02035 . 38 327 SNARE and Associated Proteins AT3G09740 72.6 5.0e-109 391.0
Lsi10g01278 . 1 254 SNARE and Associated Proteins AT3G09740 60.7 4.9e-80 294.7
Lsi03g02035 . 38 327 SNARE and Associated Proteins AT3G45280 58.7 1.6e-83 306.2
Lsi10g01278 . 1 254 SNARE and Associated Proteins AT3G45280 57.7 1.4e-74 276.6
Lsi03g02035 . 38 324 SNARE and Associated Proteins AT3G61450 62.1 1.4e-90 329.7
Lsi10g01278 . 1 251 SNARE and Associated Proteins AT3G61450 54.9 2.4e-71 265.8
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002063 3 5 2 3 2 1 3 1 2 1 1 1 3 2 2 3 1 4 3 1 2 2 1 2 2 2 1 5 3 1 65
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Lsi05g00543 Lsi_Chr05 FPKM 9.504361 11.122811 40.107124 38.78587 7.022501 8.312375 8.524105 32.56514 31.079618 33.926556