Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Lsi06g00803 ATGGAAGATTCCTCCAAATCAGCCGATGATCGGAAGACTCGTCTCTATCATCCCTACCAAGACCTGCACGTCCCGATCACCAAGCTTTACGAGCTCCCCACCGCCCCCGAGCATCTCTTCTTCGAAGAGGCCGCCAGGCCCCACCGTTCTTGGGGCGAAAACCTCCAGTACTACACCGGAATTGGCTACCTCTCCGGCGCCGTTCTCGGCGGCGCCAGGGGCTCTGTCCAGGGCCTCAGAGCGGCCGAGCCCGGCGACTCTGTCAAGCTCCGTCTCAATCGAGTTCTCAACTCTGGGGGCCAGCTTGGCCGGAGGGCTGGGAACTCCCTTGGGATCCTTGGCTTGATTTTTGCTGGTTTGGAAAGTGGGGTTATTCATTTGAGAGGTACTGATGATGTTTTGAACAGTATTGTCGCCGGATTGGGGACTGGTGCGCTTTATAAGGCGGCTTCAGGGCCTAGGTCGGCTGCCATCGCCGGTGCCATTGGAGGGATTGCCGCTGCAGCTGCAGTTGCGGGAAAGCAGGCAGTTAAGAGATATGTGCCGATATAG 552 57.97 MEDSSKSADDRKTRLYHPYQDLHVPITKLYELPTAPEHLFFEEAARPHRSWGENLQYYTGIGYLSGAVLGGARGSVQGLRAAEPGDSVKLRLNRVLNSGGQLGRRAGNSLGILGLIFAGLESGVIHLRGTDDVLNSIVAGLGTGALYKAASGPRSAAIAGAIGGIAAAAAVAGKQAVKRYVPI 183
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
6 16786457 16787008 - Lsi06G008030.1 Lsi06g00803 665533

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Lsi06g00803 183 PANTHER TIM23 1 183 IPR045238 GO:0022857
Lsi06g00803 183 Pfam Tim17/Tim22/Tim23/Pmp24 family 57 165 - -
Lsi06g00803 183 PANTHER MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM23-3 1 183 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lsi06g00803 K17794 TIM23; mitochondrial import inner membrane translocase subunit TIM23 - csv:101211511 320.857
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Lsi02g02919 Lsi-Chr2:35423583 Lsi06g00803 Lsi-Chr6:16786457 1.10E-60 transposed
Lsi11g00226 Lsi-Chr11:2283701 Lsi06g00803 Lsi-Chr6:16786457 5.24E-06 wgd
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lsi02g01367 . 1 397 Chloroplast and Mitochondria Gene Families AT2G28800 63.7 6.6e-135 477.6
Lsi08g01627 . 63 427 Chloroplast and Mitochondria Gene Families AT2G28800 53.8 5.9e-99 358.2
Lsi08g00548 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 81.2 2.6e-118 421.8
Lsi11g01355 . 46 314 Chloroplast and Mitochondria Gene Families AT3G27690 87.8 4.6e-143 504.2
Lsi10g01537 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 78.8 2.4e-120 428.7
Lsi01g00172 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 9.3e-120 426.8
Lsi01g00173 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 9.3e-120 426.8
Lsi02g00880 . 43 307 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 3.5e-119 424.9
Lsi03g01151 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.2 7.8e-119 423.7
Lsi02g00879 . 2 246 Chloroplast and Mitochondria Gene Families AT3G27690 71.9 6.2e-108 387.5
Lsi05g00685 . 3 264 Chloroplast and Mitochondria Gene Families AT3G27690 67.6 7.6e-98 354.0
Lsi02g00878 . 5 166 Chloroplast and Mitochondria Gene Families AT3G27690 71.9 1.1e-64 243.8
Lsi04g00683 . 3 262 Chloroplast and Mitochondria Gene Families AT3G61470 80.5 4.1e-124 441.0
Lsi06g00351 . 56 247 Chloroplast and Mitochondria Gene Families AT3G61470 66.1 2.1e-80 295.8
Lsi06g01458 . 378 605 Chloroplast and Mitochondria Gene Families AT3G61470 51.3 4.8e-64 241.5
Lsi02g01721 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 82.1 2.5e-90 328.6
Lsi03g02207 . 3 280 Chloroplast and Mitochondria Gene Families AT3G08940 85.3 1.3e-134 476.1
Lsi01g01533 . 3 284 Chloroplast and Mitochondria Gene Families AT3G08940 82.3 5.4e-133 470.7
Lsi06g00634 . 1 273 Chloroplast and Mitochondria Gene Families AT1G61520 85.3 1.9e-135 478.8
Lsi11g01355 . 50 314 Chloroplast and Mitochondria Gene Families AT2G05070 89.4 2.8e-144 508.1
Lsi10g01537 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 79.7 2.2e-120 428.7
Lsi01g00172 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 2.8e-120 428.3
Lsi01g00173 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 2.8e-120 428.3
Lsi02g00880 . 46 307 Chloroplast and Mitochondria Gene Families AT2G05070 77.8 1.6e-118 422.5
Lsi03g01151 . 27 265 Chloroplast and Mitochondria Gene Families AT2G05070 84.1 2.7e-118 421.8
Lsi02g00879 . 5 246 Chloroplast and Mitochondria Gene Families AT2G05070 73.3 3.2e-108 388.3
Lsi05g00685 . 5 264 Chloroplast and Mitochondria Gene Families AT2G05070 68.8 4.0e-98 354.8
Lsi02g00878 . 6 166 Chloroplast and Mitochondria Gene Families AT2G05070 72.7 2.9e-64 242.3
Lsi11g01355 . 50 286 Chloroplast and Mitochondria Gene Families AT2G05100 89.5 1.6e-125 446.0
Lsi10g01537 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 77.7 1.6e-101 366.3
Lsi01g00172 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.5 1.6e-101 366.3
Lsi01g00173 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.5 1.6e-101 366.3
Lsi02g00880 . 46 279 Chloroplast and Mitochondria Gene Families AT2G05100 76.1 1.7e-100 362.8
Lsi03g01151 . 8 237 Chloroplast and Mitochondria Gene Families AT2G05100 78.0 2.3e-100 362.5
Lsi02g00879 . 5 218 Chloroplast and Mitochondria Gene Families AT2G05100 71.1 1.4e-89 326.6
Lsi05g00685 . 5 236 Chloroplast and Mitochondria Gene Families AT2G05100 68.5 3.3e-83 305.4
Lsi02g00878 . 6 166 Chloroplast and Mitochondria Gene Families AT2G05100 72.7 1.2e-64 243.8
Lsi01g01533 . 3 167 Chloroplast and Mitochondria Gene Families AT2G40100 72.8 5.7e-67 250.8
Lsi03g02207 . 3 166 Chloroplast and Mitochondria Gene Families AT2G40100 69.2 6.5e-63 237.3
Lsi10g01537 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 4.4e-137 484.2
Lsi01g00172 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 1.1e-135 479.6
Lsi01g00173 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 1.1e-135 479.6
Lsi02g00880 . 42 307 Chloroplast and Mitochondria Gene Families AT1G29930 85.8 2.1e-131 465.3
Lsi03g01151 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29930 84.5 1.2e-126 449.5
Lsi02g00879 . 1 246 Chloroplast and Mitochondria Gene Families AT1G29930 82.0 1.6e-123 439.1
Lsi11g01355 . 52 314 Chloroplast and Mitochondria Gene Families AT1G29930 78.3 3.3e-116 414.8
Lsi05g00685 . 11 264 Chloroplast and Mitochondria Gene Families AT1G29930 67.5 3.5e-94 341.7
Lsi02g00878 . 4 167 Chloroplast and Mitochondria Gene Families AT1G29930 84.8 8.7e-77 283.9
Lsi10g01537 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 88.1 1.7e-136 482.3
Lsi01g00172 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.0 4.1e-135 477.6
Lsi01g00173 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.0 4.1e-135 477.6
Lsi02g00880 . 42 307 Chloroplast and Mitochondria Gene Families AT1G29920 85.4 8.0e-131 463.4
Lsi03g01151 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29920 84.5 1.6e-126 449.1
Lsi02g00879 . 1 246 Chloroplast and Mitochondria Gene Families AT1G29920 81.6 6.1e-123 437.2
Lsi11g01355 . 52 314 Chloroplast and Mitochondria Gene Families AT1G29920 77.9 1.9e-116 415.6
Lsi05g00685 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29920 69.8 3.5e-94 341.7
Lsi02g00878 . 4 167 Chloroplast and Mitochondria Gene Families AT1G29920 84.2 3.3e-76 282.0
Lsi10g01537 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 88.1 1.7e-136 482.3
Lsi01g00172 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.0 4.1e-135 477.6
Lsi01g00173 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.0 4.1e-135 477.6
Lsi02g00880 . 42 307 Chloroplast and Mitochondria Gene Families AT1G29910 85.4 8.0e-131 463.4
Lsi03g01151 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29910 84.5 1.6e-126 449.1
Lsi02g00879 . 1 246 Chloroplast and Mitochondria Gene Families AT1G29910 81.6 6.1e-123 437.2
Lsi11g01355 . 52 314 Chloroplast and Mitochondria Gene Families AT1G29910 77.9 1.9e-116 415.6
Lsi05g00685 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29910 69.8 3.5e-94 341.7
Lsi02g00878 . 4 167 Chloroplast and Mitochondria Gene Families AT1G29910 84.2 3.3e-76 282.0
Lsi08g00191 . 11 275 Chloroplast and Mitochondria Gene Families AT4G10340 80.1 1.5e-127 452.6
Lsi02g00880 . 82 295 Chloroplast and Mitochondria Gene Families AT4G10340 53.6 2.1e-57 219.5
Lsi01g00172 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 6.1e-57 218.0
Lsi01g00173 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 6.1e-57 218.0
Lsi10g01537 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 8.0e-57 217.6
Lsi03g01151 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 53.6 2.3e-56 216.1
Lsi11g01355 . 98 302 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 2.9e-54 209.1
Lsi05g00685 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 2.7e-52 202.6
Lsi10g01537 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 2.8e-136 481.5
Lsi01g00172 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 4.5e-134 474.2
Lsi01g00173 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 4.5e-134 474.2
Lsi02g00880 . 42 307 Chloroplast and Mitochondria Gene Families AT2G34420 85.4 3.9e-130 461.1
Lsi03g01151 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34420 84.9 2.4e-127 451.8
Lsi02g00879 . 1 246 Chloroplast and Mitochondria Gene Families AT2G34420 80.9 9.7e-121 429.9
Lsi11g01355 . 52 314 Chloroplast and Mitochondria Gene Families AT2G34420 77.2 6.5e-117 417.2
Lsi05g00685 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34420 70.2 3.5e-94 341.7
Lsi02g00878 . 4 167 Chloroplast and Mitochondria Gene Families AT2G34420 84.2 2.1e-75 279.3
Lsi01g00172 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 1.3e-136 482.6
Lsi01g00173 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 1.3e-136 482.6
Lsi10g01537 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 87.7 3.1e-135 478.0
Lsi02g00880 . 42 307 Chloroplast and Mitochondria Gene Families AT2G34430 86.1 1.7e-133 472.2
Lsi03g01151 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34430 85.2 3.4e-129 458.0
Lsi02g00879 . 1 246 Chloroplast and Mitochondria Gene Families AT2G34430 81.2 1.6e-123 439.1
Lsi11g01355 . 80 314 Chloroplast and Mitochondria Gene Families AT2G34430 83.2 1.8e-114 409.1
Lsi05g00685 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34430 71.0 3.5e-94 341.7
Lsi02g00878 . 4 167 Chloroplast and Mitochondria Gene Families AT2G34430 84.1 4.6e-78 288.1
Lsi03g02207 . 2 280 Chloroplast and Mitochondria Gene Families AT5G01530 86.8 1.6e-140 495.7
Lsi01g01533 . 2 284 Chloroplast and Mitochondria Gene Families AT5G01530 83.8 3.6e-137 484.6
Lsi05g00793 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 94.2 2.8e-144 508.1
Lsi05g00793 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 85.4 2.6e-149 525.0
Lsi10g01460 . 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 75.6 3.5e-144 508.1
Lsi01g01574 . 9 311 Chloroplast and Mitochondria Gene Families AT2G30160 63.9 1.1e-110 396.7
Lsi10g01460 . 5 327 Chloroplast and Mitochondria Gene Families AT1G07030 76.1 2.2e-143 505.4
Lsi01g01574 . 5 311 Chloroplast and Mitochondria Gene Families AT1G07030 67.2 9.5e-118 420.2
Lsi02g02438 . 1 345 Chloroplast and Mitochondria Gene Families AT2G47490 68.2 3.9e-129 458.0
Lsi02g02438 . 11 332 Chloroplast and Mitochondria Gene Families AT1G25380 57.3 5.3e-101 364.8
Lsi02g00703 . 668 1218 Chloroplast and Mitochondria Gene Families AT4G21490 74.6 2.6e-243 838.2
Lsi10g00864 . 489 1044 Chloroplast and Mitochondria Gene Families AT4G21490 71.1 1.4e-233 805.8
Lsi11g01519 . 1 577 Chloroplast and Mitochondria Gene Families AT4G21490 64.7 7.1e-225 776.9
Lsi02g02919 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 65.4 1.1e-62 236.5
Lsi06g00803 . 4 179 Chloroplast and Mitochondria Gene Families AT1G17530 59.0 1.9e-51 199.1
Lsi06g00803 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 59.0 2.0e-51 199.1
Lsi02g02919 . 22 190 Chloroplast and Mitochondria Gene Families AT3G04800 55.0 8.9e-44 173.7
Lsi02g02919 . 15 190 Chloroplast and Mitochondria Gene Families AT1G72750 69.6 5.4e-65 244.2
Lsi06g00803 . 5 183 Chloroplast and Mitochondria Gene Families AT1G72750 58.8 3.6e-53 204.9
Lsi04g00298 CCT 615 854 Chloroplast and Mitochondria Gene Families AT1G26100 57.9 5.9e-69 257.7
Lsi03g00225 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 70.5 1.0e-89 326.6
Lsi05g00005 . 23 218 Chloroplast and Mitochondria Gene Families AT4G25570 73.0 8.5e-83 303.9
Lsi09g00711 . 2 219 Chloroplast and Mitochondria Gene Families AT1G14730 52.8 4.9e-65 244.6
Lsi09g00822 . 9 370 Chloroplast and Mitochondria Gene Families AT5G14040 77.1 4.4e-159 557.8
Lsi06g01674 . 37 338 Chloroplast and Mitochondria Gene Families AT5G14040 86.1 2.5e-154 542.0
Lsi11g01295 . 31 312 Chloroplast and Mitochondria Gene Families AT5G14040 51.4 6.3e-81 298.1
Lsi05g00457 . 49 235 Chloroplast and Mitochondria Gene Families AT5G14040 64.2 1.5e-79 293.5
Lsi06g01674 . 32 338 Chloroplast and Mitochondria Gene Families AT3G48850 74.9 3.7e-139 491.5
Lsi09g00822 . 8 362 Chloroplast and Mitochondria Gene Families AT3G48850 68.1 4.7e-134 474.6
Lsi11g01295 . 31 312 Chloroplast and Mitochondria Gene Families AT3G48850 50.3 7.1e-82 301.2
Lsi05g00457 . 49 235 Chloroplast and Mitochondria Gene Families AT3G48850 62.1 5.0e-75 278.5
Lsi11g01295 . 34 311 Chloroplast and Mitochondria Gene Families AT2G17270 78.4 3.3e-128 454.9
Lsi03g00181 . 18 310 Chloroplast and Mitochondria Gene Families AT5G15640 77.0 1.3e-127 453.0
Lsi04g01400 . 12 345 Chloroplast and Mitochondria Gene Families AT5G26200 67.7 1.7e-125 446.0
Lsi02g02914 . 10 353 Chloroplast and Mitochondria Gene Families AT5G26200 58.7 1.0e-106 383.6
Lsi02g02914 . 10 357 Chloroplast and Mitochondria Gene Families AT1G72820 76.6 1.0e-149 526.6
Lsi04g01400 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 68.2 1.5e-129 459.5
Lsi05g01196 . 1 223 Chloroplast and Mitochondria Gene Families AT4G25700 62.6 1.1e-69 260.0
Lsi09g00227 . 28 187 Chloroplast and Mitochondria Gene Families AT4G25700 53.5 6.7e-46 181.0
Lsi11g01501 . 123 301 Chloroplast and Mitochondria Gene Families AT4G03320 51.7 3.1e-56 215.7
Lsi05g00688 . 62 386 Chloroplast and Mitochondria Gene Families AT5G54290 70.6 4.8e-115 411.4
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0011351 1 1 1 0 1 1 2 1 1 1 1 1 2 1 1 2 1 0 2 1 1 1 1 1 1 1 0 1 1 1 31
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Lsi06g00803 Lsi_Chr06 FPKM 53.239582 57.953182 10.210636 12.684964 11.849197 9.498796 11.896016 46.569489 47.810329 45.135136