Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Lsi10g01278 ATGACCGTAATCGACATCATCTTCCGAGTCGATTCCATTTGCAAGAAATACGAGAAGTATGATGTCGAGAAGCAGCGTGAGCTCAATGCTTATGGTAACGATGCCTTTGCTCGCCTCTTTGACGCCGTTGAAGTCGAAATCCACGCCGCTCTCCAGAAATCTGAGGATGCCTCAAATGAGAAGAATAGGGCTGCTGCAGTTGCCATGAACGCTGAGGTTCGACGGAAGAAGGCCCGATTGATGGATGAAGTCCCTAAGCTTCGTAAATTGGCTCATAAGAAGGTTAAAGGGGTTCCGAAAGAAGAGCTCGAGGTCAGAGATGATCTTGTTCTTGCGCTTGAAGAGAAGATTAAAGCCATACCAGATGGGAGTACCTCAGGAGCCAAACAATCTGGAGGATGGGGGTCCTCCTCCTCATCTAACAATATCAAGTTTGATTCATCAGATGGAAACTTTGAGAGCGAGCATTTCCAGCAAAGTGAAGAATCAAGCCAATTTCGAAATGAGTATGAAATGCGGAAGATGAAACAGGCATGTGAGACCAAGGTCTCGATGTCATATCTGAAGGAATTGGACAGGCAAGTTCCATTAATTGACGAGATCGACGCAAAGGTAGACAAGGTGACTGATGAGATTAAAAATACCAATGTTAGGCTGAAGGAAACGCTCTATGAGGTGAGATCCAGCCAAAACTTCTGCATTGATATTGTTCTTCTCTGTATAATTCTTGGAATTGCTTCTTACTTGTACAATATATTGAGCTGA 765 44.18 MTVIDIIFRVDSICKKYEKYDVEKQRELNAYGNDAFARLFDAVEVEIHAALQKSEDASNEKNRAAAVAMNAEVRRKKARLMDEVPKLRKLAHKKVKGVPKEELEVRDDLVLALEEKIKAIPDGSTSGAKQSGGWGSSSSSNNIKFDSSDGNFESEHFQQSEESSQFRNEYEMRKMKQACETKVSMSYLKELDRQVPLIDEIDAKVDKVTDEIKNTNVRLKETLYEVRSSQNFCIDIVLLCIILGIASYLYNILS 254
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
10 17020737 17023570 - Lsi10G012780.1 Lsi10g01278 672835

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Lsi10g01278 254 Coils Coil 198 218 - -
Lsi10g01278 254 CDD SNARE_Qc 190 221 - -
Lsi10g01278 254 Pfam SNARE domain 197 246 IPR000727 -
Lsi10g01278 254 MobiDBLite consensus disorder prediction 122 168 - -
Lsi10g01278 254 MobiDBLite consensus disorder prediction 124 159 - -
Lsi10g01278 254 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 183 222 IPR000727 -
Lsi10g01278 254 PANTHER SYNTAXIN-72 1 251 - -
Lsi10g01278 254 PANTHER SYNTAXIN 1 251 IPR045242 -
Lsi10g01278 254 Gene3D - 183 221 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lsi10g01278 K08506 SYP7; syntaxin of plants SYP7 - csv:101211289 393.275
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Lsi10g01278 Lsi-Chr10:17020737 Lsi03g02035 Lsi-Chr3:31718590 1.38E-102 wgd
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lsi08g01147 . 8 338 SNARE and Associated Proteins AT3G24350 65.1 4.7e-102 368.2
Lsi01g01659 . 1 309 SNARE and Associated Proteins AT1G08560 69.0 1.0e-100 363.6
Lsi01g00668 . 428 710 SNARE and Associated Proteins AT2G18260 55.2 2.3e-81 299.3
Lsi03g01810 . 19 254 SNARE and Associated Proteins AT3G11820 80.5 1.4e-102 369.8
Lsi01g01181 . 26 282 SNARE and Associated Proteins AT3G11820 73.2 2.4e-102 369.0
Lsi02g00706 . 31 281 SNARE and Associated Proteins AT3G11820 66.9 7.8e-93 337.4
Lsi03g01319 . 12 236 SNARE and Associated Proteins AT3G11820 55.6 1.7e-63 240.0
Lsi01g01181 . 33 282 SNARE and Associated Proteins AT3G52400 65.2 6.5e-85 311.2
Lsi03g01810 . 1 255 SNARE and Associated Proteins AT3G52400 63.7 3.0e-82 302.4
Lsi02g00706 . 1 281 SNARE and Associated Proteins AT3G52400 56.7 1.5e-81 300.1
Lsi03g01319 . 11 236 SNARE and Associated Proteins AT3G52400 52.7 3.7e-56 215.7
Lsi02g00706 . 1 299 SNARE and Associated Proteins AT4G03330 68.5 2.4e-107 385.6
Lsi01g01181 . 1 298 SNARE and Associated Proteins AT4G03330 51.5 9.0e-78 287.3
Lsi03g01810 . 1 253 SNARE and Associated Proteins AT4G03330 59.1 2.9e-76 282.3
Lsi03g01319 . 10 236 SNARE and Associated Proteins AT4G03330 57.3 3.3e-64 242.3
Lsi02g00706 . 1 299 SNARE and Associated Proteins AT1G61290 78.6 4.7e-127 451.1
Lsi01g01181 . 1 293 SNARE and Associated Proteins AT1G61290 56.3 7.5e-85 310.8
Lsi03g01810 . 1 254 SNARE and Associated Proteins AT1G61290 63.8 7.1e-83 304.3
Lsi03g01319 . 10 236 SNARE and Associated Proteins AT1G61290 52.9 2.9e-60 229.2
Lsi02g00706 . 1 299 SNARE and Associated Proteins AT1G11250 77.6 4.7e-124 441.0
Lsi01g01181 . 1 293 SNARE and Associated Proteins AT1G11250 57.0 6.1e-87 317.8
Lsi03g01810 . 1 254 SNARE and Associated Proteins AT1G11250 63.0 9.7e-85 310.5
Lsi03g01319 . 12 236 SNARE and Associated Proteins AT1G11250 54.7 2.3e-62 236.1
Lsi03g01319 . 12 259 SNARE and Associated Proteins AT3G03800 76.6 5.4e-99 357.8
Lsi03g01319 . 12 154 SNARE and Associated Proteins AT5G08080 83.2 1.2e-60 229.9
Lsi07g01177 . 1 272 SNARE and Associated Proteins AT5G16830 56.5 8.0e-73 270.8
Lsi07g01177 . 1 272 SNARE and Associated Proteins AT5G46860 62.5 1.3e-77 286.6
Lsi07g01177 . 1 190 SNARE and Associated Proteins AT4G17730 76.4 1.7e-72 269.6
Lsi07g01177 . 65 272 SNARE and Associated Proteins AT1G32270 55.3 1.4e-50 197.2
Lsi04g00969 . 1 286 SNARE and Associated Proteins AT5G05760 64.5 6.6e-90 327.8
Lsi08g01147 . 8 338 SNARE and Associated Proteins AT3G24350 65.1 4.7e-102 368.2
Lsi11g00612 . 1 327 SNARE and Associated Proteins AT5G26980 75.8 1.1e-126 449.9
Lsi02g02441 . 1 286 SNARE and Associated Proteins AT5G26980 64.8 2.7e-88 322.4
Lsi11g00612 . 1 329 SNARE and Associated Proteins AT4G02195 64.7 3.7e-106 381.7
Lsi02g02441 . 1 286 SNARE and Associated Proteins AT4G02195 66.9 3.6e-93 338.6
Lsi11g00612 . 1 328 SNARE and Associated Proteins AT3G05710 75.4 9.3e-129 456.8
Lsi02g02441 . 1 286 SNARE and Associated Proteins AT3G05710 62.5 2.8e-85 312.4
Lsi02g01877 . 1 225 SNARE and Associated Proteins AT1G16240 69.5 2.4e-83 305.4
Lsi05g00543 . 23 286 SNARE and Associated Proteins AT1G16240 57.6 7.1e-75 277.3
Lsi02g01877 . 1 225 SNARE and Associated Proteins AT1G79590 68.7 2.3e-82 302.4
Lsi05g00543 . 23 286 SNARE and Associated Proteins AT1G79590 58.3 4.3e-76 281.6
Lsi09g01890 . 38 229 SNARE and Associated Proteins AT1G28490 72.9 3.2e-68 255.0
Lsi03g02035 . 38 327 SNARE and Associated Proteins AT3G09740 72.6 5.0e-109 391.0
Lsi10g01278 . 1 254 SNARE and Associated Proteins AT3G09740 60.7 4.9e-80 294.7
Lsi03g02035 . 38 327 SNARE and Associated Proteins AT3G45280 58.7 1.6e-83 306.2
Lsi10g01278 . 1 254 SNARE and Associated Proteins AT3G45280 57.7 1.4e-74 276.6
Lsi03g02035 . 38 324 SNARE and Associated Proteins AT3G61450 62.1 1.4e-90 329.7
Lsi10g01278 . 1 251 SNARE and Associated Proteins AT3G61450 54.9 2.4e-71 265.8
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002038 1 2 1 1 1 2 3 2 2 2 2 2 3 3 2 3 2 2 3 2 3 2 2 2 2 2 3 2 2 2 63