Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Mch11g1356 ATGTCTTACAGGTTCGTGCTTTGGAGCGGGCGCTGGTGTCCTGGGTATAGGAAAGCAAGCAAAGCTCCGATTCCTAGTTCTAAAAAAAGAAAGAATAATAAAATTCTTTTAACATTGGTACTAATTTTGAGTGAGAGGCTCCATTCGGTAACATCACAATTTGATAAGATAAGAGCCATTCGATTTCAAGATATCATAAACAAAGCAGTACCAAGAAGAAAACCAAACCAGGTAACTAAACCTCGTTCTGCAGATACCCCTGAATATAATAATACGGAGCTGAAGGAAACTACTACTTTTGAGCATGAACCTGTCCGAGCCCAACAGCAACTGTTGGATGATGAAACTCGCACTTCAGGTGTTTTCTTCCAAATTTTTCTGGTTGAGTTGATTAGTCTTCTTGATGCAGTCCAAGAAACAGAAACTAAGATGGTTGAGATGTCTGCTTTGAATCACCTTATGTCTACCCACGTTTTGCAACAAGCACAACAGATTGAATTTCTTTATGAACAGGCTGTTAAAACTACGAAGAATGTTGAGGGTAATAAAGAACTTTCCCAAGCAATTCAGCGGAATAGCAGCAGCAGAACGTTCCTTCTTCTTTTTCTATTTGTGCTCACCTTTTCAATTCTTTTTCTTGATTGGTATAGT 651 38.71 MSYRFVLWSGRWCPGYRKASKAPIPSSKKRKNNKILLTLVLILSERLHSVTSQFDKIRAIRFQDIINKAVPRRKPNQVTKPRSADTPEYNNTELKETTTFEHEPVRAQQQLLDDETRTSGVFFQIFLVELISLLDAVQETETKMVEMSALNHLMSTHVLQQAQQIEFLYEQAVKTTKNVEGNKELSQAIQRNSSSRTFLLLFLFVLTFSILFLDWYS 217
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
11 9709048 9710796 + MC11g1124 Mch11g1356 680290

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Mch11g1356 217 Gene3D - 128 214 - -
Mch11g1356 217 PANTHER SYNTAXIN-18 38 217 - GO:0005783(PANTHER)|GO:0006890(PANTHER)|GO:0031201(PANTHER)
Mch11g1356 217 FunFam Syntaxin-81 like 122 214 - -
Mch11g1356 217 MobiDBLite consensus disorder prediction 73 100 - -
Mch11g1356 217 MobiDBLite consensus disorder prediction 80 94 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Mch11g1356 K08492 - - csv:101207161 266.929
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Mch11g1356 Mch-Chr11:9709048 Mch4g2528 Mch-Chr4:25926132 5.07E-81 dispersed
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Mch8g0402 . 8 342 SNARE and Associated Proteins AT3G24350 66.1 2.2e-104 375.9
Mch1g0568 . 39 346 SNARE and Associated Proteins AT1G08560 66.2 2.5e-101 365.5
Mch1g1511 . 450 751 SNARE and Associated Proteins AT2G18260 53.7 5.2e-83 304.7
Mch5g1533 . 19 279 SNARE and Associated Proteins AT3G11820 82.4 1.5e-117 419.5
Mch1g0981 . 21 280 SNARE and Associated Proteins AT3G11820 73.5 1.6e-103 372.9
Mch3g1169 . 31 281 SNARE and Associated Proteins AT3G11820 64.9 1.1e-91 333.6
Mch5g1220 . 25 277 SNARE and Associated Proteins AT3G11820 52.6 1.1e-67 253.8
Mch5g1533 . 1 279 SNARE and Associated Proteins AT3G52400 64.6 1.6e-93 339.7
Mch1g0981 . 32 280 SNARE and Associated Proteins AT3G52400 65.9 3.9e-87 318.5
Mch3g1169 . 1 281 SNARE and Associated Proteins AT3G52400 55.7 1.6e-80 296.6
Mch3g1169 . 1 299 SNARE and Associated Proteins AT4G03330 68.5 9.4e-109 390.2
Mch5g1533 . 1 280 SNARE and Associated Proteins AT4G03330 58.4 2.1e-84 309.3
Mch1g0981 . 1 286 SNARE and Associated Proteins AT4G03330 51.9 3.3e-77 285.4
Mch3g1169 . 1 303 SNARE and Associated Proteins AT1G61290 77.9 4.0e-128 454.5
Mch5g1533 . 1 280 SNARE and Associated Proteins AT1G61290 62.4 1.0e-91 333.6
Mch1g0981 . 1 292 SNARE and Associated Proteins AT1G61290 55.5 3.0e-83 305.4
Mch3g1169 . 1 303 SNARE and Associated Proteins AT1G11250 76.9 3.1e-125 444.9
Mch5g1533 . 1 280 SNARE and Associated Proteins AT1G11250 62.9 3.8e-94 341.7
Mch1g0981 . 1 289 SNARE and Associated Proteins AT1G11250 56.4 2.4e-85 312.4
Mch5g1220 . 1 301 SNARE and Associated Proteins AT3G03800 73.4 2.8e-113 405.2
Mch2g0632 . 1 305 SNARE and Associated Proteins AT3G03800 57.5 4.0e-83 305.1
Mch5g1220 . 1 195 SNARE and Associated Proteins AT5G08080 77.5 3.7e-78 288.1
Mch2g0632 . 1 204 SNARE and Associated Proteins AT5G08080 60.3 6.3e-54 207.6
Mch10g1680 . 1 256 SNARE and Associated Proteins AT5G16830 58.8 1.4e-74 276.6
Mch10g1680 . 1 256 SNARE and Associated Proteins AT5G46860 66.0 2.3e-79 292.4
Mch10g1680 . 1 256 SNARE and Associated Proteins AT4G17730 61.7 1.4e-73 273.1
Mch10g1680 . 65 256 SNARE and Associated Proteins AT1G32270 60.9 6.3e-53 204.9
Mch9g1485 . 1 334 SNARE and Associated Proteins AT5G05760 66.3 5.9e-112 401.0
Mch8g0402 . 8 342 SNARE and Associated Proteins AT3G24350 66.1 2.2e-104 375.9
Mch8g2794 . 1 327 SNARE and Associated Proteins AT5G26980 76.5 1.6e-127 452.6
Mch9g0690 . 1 319 SNARE and Associated Proteins AT5G26980 67.9 1.8e-105 379.4
Mch11g1612 . 1 114 SNARE and Associated Proteins AT5G26980 70.4 1.7e-36 150.2
Mch8g2794 . 1 330 SNARE and Associated Proteins AT4G02195 65.4 7.1e-107 384.0
Mch9g0690 . 1 319 SNARE and Associated Proteins AT4G02195 67.1 1.2e-106 383.3
Mch8g2794 . 1 328 SNARE and Associated Proteins AT3G05710 75.4 4.4e-128 454.5
Mch9g0690 . 1 322 SNARE and Associated Proteins AT3G05710 64.2 1.0e-100 363.6
Mch11g1220 . 1 226 SNARE and Associated Proteins AT1G16240 69.2 5.7e-82 300.8
Mch11g1220 . 1 226 SNARE and Associated Proteins AT1G79590 68.4 1.4e-81 299.7
Mch11g1194 . 56 247 SNARE and Associated Proteins AT1G28490 71.4 1.1e-65 246.5
Mch5g1759 . 1 261 SNARE and Associated Proteins AT3G09740 79.5 6.7e-111 397.1
Mch2g0282 . 1 261 SNARE and Associated Proteins AT3G09740 66.3 1.9e-89 325.9
Mch2g0362 . 1 262 SNARE and Associated Proteins AT3G09740 65.7 3.2e-89 325.1
Mch5g1759 . 1 261 SNARE and Associated Proteins AT3G45280 64.0 1.2e-86 316.6
Mch2g0362 . 1 262 SNARE and Associated Proteins AT3G45280 63.4 1.3e-82 303.1
Mch2g0282 . 1 261 SNARE and Associated Proteins AT3G45280 63.6 2.3e-82 302.4
Mch5g1759 . 1 261 SNARE and Associated Proteins AT3G61450 67.8 6.6e-95 344.0
Mch2g0362 . 1 262 SNARE and Associated Proteins AT3G61450 57.2 8.7e-79 290.4
Mch2g0282 . 1 261 SNARE and Associated Proteins AT3G61450 57.4 2.5e-78 288.9
Mch4g2528 . 65 303 SNARE and Associated Proteins AT1G51740 72.4 4.6e-90 327.8
Mch11g1356 . 39 217 SNARE and Associated Proteins AT1G51740 68.5 4.8e-55 211.5
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0011407 0 1 0 1 0 1 1 1 1 1 1 1 1 1 1 1 1 2 2 1 1 1 1 1 1 1 2 1 1 1 30