Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Mch11g1612 ATGGCGTCGAGGAATCGGACTTTGCTTTTTAGGAAATACAGGGACGCCTTGAGAAGTGTGAGGGCTCCTACCAGCTCTTCGCCAATTTCAGCATCGCCACCGACTAGTTCTGGCGGTGGTGGTCCGGTGATTGAATTGGTGAGCTCGTTGTTGCTGAATCCGAATCGGACTTATGCTCCCTTGAGTACTGAGGATGGTAATTCAAGTAAGGGTGCTCATACCGTGGGTCTGCCTCCTGCTTGGGTCGATCTATCCGAAGAAATAGCTGCAAATGTGCTACGTGCACGAGCAAAGATGATGGAGTTAGATAAAGCTCATGCGAAGGCTTTAATGCCTTCATTT 342 49.42 MASRNRTLLFRKYRDALRSVRAPTSSSPISASPPTSSGGGGPVIELVSSLLLNPNRTYAPLSTEDGNSSKGAHTVGLPPAWVDLSEEIAANVLRARAKMMELDKAHAKALMPSF 114
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
11 14667505 14668620 + MC11g1275 Mch11g1612 680546

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Mch11g1612 114 MobiDBLite consensus disorder prediction 20 37 - -
Mch11g1612 114 MobiDBLite consensus disorder prediction 18 43 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Mch11g1612 K08489 - - csv:101207998 167.162
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Mch11g1612 Mch-Chr11:14667505 Mch8g2794 Mch-Chr8:30939086 1.39E-59 dispersed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Mch8g0402 . 8 342 SNARE and Associated Proteins AT3G24350 66.1 2.2e-104 375.9
Mch1g0568 . 39 346 SNARE and Associated Proteins AT1G08560 66.2 2.5e-101 365.5
Mch1g1511 . 450 751 SNARE and Associated Proteins AT2G18260 53.7 5.2e-83 304.7
Mch5g1533 . 19 279 SNARE and Associated Proteins AT3G11820 82.4 1.5e-117 419.5
Mch1g0981 . 21 280 SNARE and Associated Proteins AT3G11820 73.5 1.6e-103 372.9
Mch3g1169 . 31 281 SNARE and Associated Proteins AT3G11820 64.9 1.1e-91 333.6
Mch5g1220 . 25 277 SNARE and Associated Proteins AT3G11820 52.6 1.1e-67 253.8
Mch5g1533 . 1 279 SNARE and Associated Proteins AT3G52400 64.6 1.6e-93 339.7
Mch1g0981 . 32 280 SNARE and Associated Proteins AT3G52400 65.9 3.9e-87 318.5
Mch3g1169 . 1 281 SNARE and Associated Proteins AT3G52400 55.7 1.6e-80 296.6
Mch3g1169 . 1 299 SNARE and Associated Proteins AT4G03330 68.5 9.4e-109 390.2
Mch5g1533 . 1 280 SNARE and Associated Proteins AT4G03330 58.4 2.1e-84 309.3
Mch1g0981 . 1 286 SNARE and Associated Proteins AT4G03330 51.9 3.3e-77 285.4
Mch3g1169 . 1 303 SNARE and Associated Proteins AT1G61290 77.9 4.0e-128 454.5
Mch5g1533 . 1 280 SNARE and Associated Proteins AT1G61290 62.4 1.0e-91 333.6
Mch1g0981 . 1 292 SNARE and Associated Proteins AT1G61290 55.5 3.0e-83 305.4
Mch3g1169 . 1 303 SNARE and Associated Proteins AT1G11250 76.9 3.1e-125 444.9
Mch5g1533 . 1 280 SNARE and Associated Proteins AT1G11250 62.9 3.8e-94 341.7
Mch1g0981 . 1 289 SNARE and Associated Proteins AT1G11250 56.4 2.4e-85 312.4
Mch5g1220 . 1 301 SNARE and Associated Proteins AT3G03800 73.4 2.8e-113 405.2
Mch2g0632 . 1 305 SNARE and Associated Proteins AT3G03800 57.5 4.0e-83 305.1
Mch5g1220 . 1 195 SNARE and Associated Proteins AT5G08080 77.5 3.7e-78 288.1
Mch2g0632 . 1 204 SNARE and Associated Proteins AT5G08080 60.3 6.3e-54 207.6
Mch10g1680 . 1 256 SNARE and Associated Proteins AT5G16830 58.8 1.4e-74 276.6
Mch10g1680 . 1 256 SNARE and Associated Proteins AT5G46860 66.0 2.3e-79 292.4
Mch10g1680 . 1 256 SNARE and Associated Proteins AT4G17730 61.7 1.4e-73 273.1
Mch10g1680 . 65 256 SNARE and Associated Proteins AT1G32270 60.9 6.3e-53 204.9
Mch9g1485 . 1 334 SNARE and Associated Proteins AT5G05760 66.3 5.9e-112 401.0
Mch8g0402 . 8 342 SNARE and Associated Proteins AT3G24350 66.1 2.2e-104 375.9
Mch8g2794 . 1 327 SNARE and Associated Proteins AT5G26980 76.5 1.6e-127 452.6
Mch9g0690 . 1 319 SNARE and Associated Proteins AT5G26980 67.9 1.8e-105 379.4
Mch11g1612 . 1 114 SNARE and Associated Proteins AT5G26980 70.4 1.7e-36 150.2
Mch8g2794 . 1 330 SNARE and Associated Proteins AT4G02195 65.4 7.1e-107 384.0
Mch9g0690 . 1 319 SNARE and Associated Proteins AT4G02195 67.1 1.2e-106 383.3
Mch8g2794 . 1 328 SNARE and Associated Proteins AT3G05710 75.4 4.4e-128 454.5
Mch9g0690 . 1 322 SNARE and Associated Proteins AT3G05710 64.2 1.0e-100 363.6
Mch11g1220 . 1 226 SNARE and Associated Proteins AT1G16240 69.2 5.7e-82 300.8
Mch11g1220 . 1 226 SNARE and Associated Proteins AT1G79590 68.4 1.4e-81 299.7
Mch11g1194 . 56 247 SNARE and Associated Proteins AT1G28490 71.4 1.1e-65 246.5
Mch5g1759 . 1 261 SNARE and Associated Proteins AT3G09740 79.5 6.7e-111 397.1
Mch2g0282 . 1 261 SNARE and Associated Proteins AT3G09740 66.3 1.9e-89 325.9
Mch2g0362 . 1 262 SNARE and Associated Proteins AT3G09740 65.7 3.2e-89 325.1
Mch5g1759 . 1 261 SNARE and Associated Proteins AT3G45280 64.0 1.2e-86 316.6
Mch2g0362 . 1 262 SNARE and Associated Proteins AT3G45280 63.4 1.3e-82 303.1
Mch2g0282 . 1 261 SNARE and Associated Proteins AT3G45280 63.6 2.3e-82 302.4
Mch5g1759 . 1 261 SNARE and Associated Proteins AT3G61450 67.8 6.6e-95 344.0
Mch2g0362 . 1 262 SNARE and Associated Proteins AT3G61450 57.2 8.7e-79 290.4
Mch2g0282 . 1 261 SNARE and Associated Proteins AT3G61450 57.4 2.5e-78 288.9
Mch4g2528 . 65 303 SNARE and Associated Proteins AT1G51740 72.4 4.6e-90 327.8
Mch11g1356 . 39 217 SNARE and Associated Proteins AT1G51740 68.5 4.8e-55 211.5