Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Mch3g1006 ATGGCTCTCTCCTCTCCGTCACTCGCCGGAAAGGCGGTGAAGCTCACGCCCTCTTCCCCCGAGCTTCTCGGCAATGGGAGAGTCAGCATGAGAAAATTTGTCTCCAAGTCCGTTTCTTCTGGGAGCCCATGGTACGGACCCGACCGTGTCAAATATTTGGGCCCATTCTCCGGTGAGCCTCCATCCTACCTCACCGGAGAATTCCCTGGAGACTATGGTTGGGATACCGCCGGACTTTCTGCAGATCCCGAGACCTTTGCCAAGAATCGTGAGCTCGAAGTCATACACTCCAGGTGGGCTATGCTTGGGGCCTTGGGCTGCGTGTTCCCAGAGCTTCTATCCCGCAACGGTGTGAAATTCGGGGAAGCGGTATGGTTCAAGGCTGGATCTCAGATCTTCAATGAAGGTGGGCTCGACTACTTGGGCAACCCCAGCTTGATCCACGCACAGAGCATTTTAGCCATTTGGGCTTCCCAAGTAGTTCTAATGGGAGCCGTCGAGGGATACCGTATTGCCGGTGGTCCACTCGGCGAGGTGACCGACCCGATCTACCCGGGTGGGAGCTTTGACCCGTTGGGACTTGCAGATGACCCGGAAGCATTTGCAGAGCTGAAGGTGAAGGAGCTTAAGAATGGAAGGTTGGCGATGTTCTCCATGTTTGGTTTCTTCGTTCAGGCTATTGTCACCGGAAAAGGTCCATTGGAGAACCTTGCTGACCATTTGGCTGACCCAGTCAACAACAATGCTTGGGCTTACGCCACCGACTTTGTTCCTGGAAAATAA 783 54.41 MALSSPSLAGKAVKLTPSSPELLGNGRVSMRKFVSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFNEGGLDYLGNPSLIHAQSILAIWASQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATDFVPGK 260
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
3 13782717 13784436 + MC03g_new0318 Mch3g1006 683909

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Mch3g1006 260 FunFam Chlorophyll a-b binding protein, chloroplastic 51 253 - -
Mch3g1006 260 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 1 260 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0009941(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Mch3g1006 260 Pfam Chlorophyll A-B binding protein 60 227 IPR022796 -
Mch3g1006 260 SUPERFAMILY Chlorophyll a-b binding protein 43 257 - -
Mch3g1006 260 Gene3D Chlorophyll a/b binding protein domain 51 253 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Mch3g1006 K08912 - - csv:101211276 514.612
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Mch3g1003 Mch-Chr3:13775686 Mch3g1006 Mch-Chr3:13782717 3.65E-189 dispersed
Mch3g1006 Mch-Chr3:13782717 Mch8g2102 Mch-Chr8:24052749 9.10E-153 dispersed
Mch3g1005 Mch-Chr3:13779783 Mch3g1006 Mch-Chr3:13782717 1.08E-190 tandem
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Mch8g0068 . 71 411 Chloroplast and Mitochondria Gene Families AT2G28800 56.4 2.8e-98 355.9
Mch4g0334 . 1 266 Chloroplast and Mitochondria Gene Families AT3G27690 89.1 3.3e-143 504.6
Mch3g1003 . 3 270 Chloroplast and Mitochondria Gene Families AT3G27690 77.4 1.4e-120 429.5
Mch1g2002 . 45 308 Chloroplast and Mitochondria Gene Families AT3G27690 77.8 3.0e-120 428.3
Mch1g2004 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.8 3.0e-120 428.3
Mch2g0724 . 2 268 Chloroplast and Mitochondria Gene Families AT3G27690 77.7 5.2e-120 427.6
Mch3g1005 . 2 261 Chloroplast and Mitochondria Gene Families AT3G27690 78.2 4.4e-119 424.5
Mch3g1006 . 2 261 Chloroplast and Mitochondria Gene Families AT3G27690 77.8 3.7e-118 421.4
Mch8g2102 . 5 211 Chloroplast and Mitochondria Gene Families AT3G27690 87.4 1.6e-108 389.4
Mch10g1131 . 5 265 Chloroplast and Mitochondria Gene Families AT3G27690 66.5 9.5e-98 353.6
Mch11g0017 . 111 327 Chloroplast and Mitochondria Gene Families AT3G27690 51.2 6.5e-54 208.0
Mch11g1702 . 72 275 Chloroplast and Mitochondria Gene Families AT3G27690 52.6 1.0e-51 200.7
Mch9g2370 . 3 268 Chloroplast and Mitochondria Gene Families AT3G61470 81.7 5.8e-128 453.8
Mch6g0991 . 56 260 Chloroplast and Mitochondria Gene Families AT3G61470 66.8 1.5e-86 316.2
Mch6g0241 . 22 249 Chloroplast and Mitochondria Gene Families AT3G61470 51.3 2.0e-64 242.7
Mch4g2062 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 82.4 8.1e-91 330.1
Mch1g0627 . 3 287 Chloroplast and Mitochondria Gene Families AT3G08940 84.3 1.4e-138 489.2
Mch11g0017 . 19 334 Chloroplast and Mitochondria Gene Families AT1G76570 75.2 1.3e-143 506.1
Mch6g1282 . 1 274 Chloroplast and Mitochondria Gene Families AT1G61520 85.4 8.1e-136 479.9
Mch4g0334 . 1 266 Chloroplast and Mitochondria Gene Families AT2G05070 88.7 5.1e-143 503.8
Mch3g1003 . 9 270 Chloroplast and Mitochondria Gene Families AT2G05070 79.4 7.1e-121 430.3
Mch1g2002 . 48 308 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 2.7e-120 428.3
Mch1g2004 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 2.7e-120 428.3
Mch2g0724 . 7 268 Chloroplast and Mitochondria Gene Families AT2G05070 79.4 2.7e-120 428.3
Mch3g1005 . 2 261 Chloroplast and Mitochondria Gene Families AT2G05070 79.2 6.0e-120 427.2
Mch3g1006 . 2 261 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 5.1e-119 424.1
Mch8g2102 . 5 211 Chloroplast and Mitochondria Gene Families AT2G05070 87.4 1.5e-107 386.0
Mch10g1131 . 8 265 Chloroplast and Mitochondria Gene Families AT2G05070 67.8 1.4e-97 352.8
Mch11g0017 . 111 327 Chloroplast and Mitochondria Gene Families AT2G05070 50.2 1.9e-52 203.0
Mch11g1702 . 72 275 Chloroplast and Mitochondria Gene Families AT2G05070 53.1 7.0e-52 201.1
Mch4g0334 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.0 9.7e-125 443.4
Mch3g1003 . 9 241 Chloroplast and Mitochondria Gene Families AT2G05100 77.8 4.0e-102 368.2
Mch1g2002 . 48 280 Chloroplast and Mitochondria Gene Families AT2G05100 77.3 1.2e-101 366.7
Mch1g2004 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.3 1.2e-101 366.7
Mch2g0724 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 77.8 2.6e-101 365.5
Mch3g1005 . 2 232 Chloroplast and Mitochondria Gene Families AT2G05100 77.6 3.4e-101 365.2
Mch3g1006 . 2 232 Chloroplast and Mitochondria Gene Families AT2G05100 77.6 7.5e-101 364.0
Mch8g2102 . 5 195 Chloroplast and Mitochondria Gene Families AT2G05100 86.9 3.9e-97 351.7
Mch10g1131 . 8 236 Chloroplast and Mitochondria Gene Families AT2G05100 67.2 1.6e-82 303.1
Mch11g1702 . 72 259 Chloroplast and Mitochondria Gene Families AT2G05100 51.8 2.5e-43 172.9
Mch1g0627 . 4 169 Chloroplast and Mitochondria Gene Families AT2G40100 73.3 2.9e-68 255.0
Mch2g0724 . 1 268 Chloroplast and Mitochondria Gene Families AT1G29930 88.1 7.2e-137 483.4
Mch1g2002 . 44 308 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 9.4e-137 483.0
Mch1g2004 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 9.4e-137 483.0
Mch3g1003 . 5 270 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 2.1e-136 481.9
Mch3g1005 . 1 261 Chloroplast and Mitochondria Gene Families AT1G29930 87.5 2.2e-133 471.9
Mch3g1006 . 1 261 Chloroplast and Mitochondria Gene Families AT1G29930 87.1 1.8e-132 468.8
Mch4g0334 . 3 266 Chloroplast and Mitochondria Gene Families AT1G29930 78.4 1.4e-116 416.0
Mch8g2102 . 3 211 Chloroplast and Mitochondria Gene Families AT1G29930 91.9 7.2e-113 403.7
Mch10g1131 . 46 265 Chloroplast and Mitochondria Gene Families AT1G29930 75.1 1.2e-94 343.2
Mch11g1702 . 72 275 Chloroplast and Mitochondria Gene Families AT1G29930 52.4 1.1e-52 203.8
Mch2g0724 . 1 268 Chloroplast and Mitochondria Gene Families AT1G29920 87.7 2.7e-136 481.5
Mch1g2002 . 44 308 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 3.6e-136 481.1
Mch1g2004 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 3.6e-136 481.1
Mch3g1003 . 5 270 Chloroplast and Mitochondria Gene Families AT1G29920 88.1 7.9e-136 479.9
Mch3g1005 . 1 261 Chloroplast and Mitochondria Gene Families AT1G29920 87.1 8.2e-133 469.9
Mch3g1006 . 1 261 Chloroplast and Mitochondria Gene Families AT1G29920 86.7 6.9e-132 466.8
Mch4g0334 . 30 266 Chloroplast and Mitochondria Gene Families AT1G29920 83.4 1.8e-116 415.6
Mch8g2102 . 3 211 Chloroplast and Mitochondria Gene Families AT1G29920 91.9 7.2e-113 403.7
Mch10g1131 . 46 265 Chloroplast and Mitochondria Gene Families AT1G29920 75.1 1.2e-94 343.2
Mch11g1702 . 72 275 Chloroplast and Mitochondria Gene Families AT1G29920 52.4 1.1e-52 203.8
Mch2g0724 . 1 268 Chloroplast and Mitochondria Gene Families AT1G29910 87.7 2.7e-136 481.5
Mch1g2002 . 44 308 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 3.6e-136 481.1
Mch1g2004 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 3.6e-136 481.1
Mch3g1003 . 5 270 Chloroplast and Mitochondria Gene Families AT1G29910 88.1 7.9e-136 479.9
Mch3g1005 . 1 261 Chloroplast and Mitochondria Gene Families AT1G29910 87.1 8.2e-133 469.9
Mch3g1006 . 1 261 Chloroplast and Mitochondria Gene Families AT1G29910 86.7 6.9e-132 466.8
Mch4g0334 . 30 266 Chloroplast and Mitochondria Gene Families AT1G29910 83.4 1.8e-116 415.6
Mch8g2102 . 3 211 Chloroplast and Mitochondria Gene Families AT1G29910 91.9 7.2e-113 403.7
Mch10g1131 . 46 265 Chloroplast and Mitochondria Gene Families AT1G29910 75.1 1.2e-94 343.2
Mch11g1702 . 72 275 Chloroplast and Mitochondria Gene Families AT1G29910 52.4 1.1e-52 203.8
Mch11g1702 . 11 291 Chloroplast and Mitochondria Gene Families AT4G10340 84.3 6.4e-136 480.3
Mch3g1005 . 32 248 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 9.1e-58 220.7
Mch3g1003 . 41 257 Chloroplast and Mitochondria Gene Families AT4G10340 52.9 1.2e-57 220.3
Mch1g2002 . 80 296 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 2.0e-57 219.5
Mch1g2004 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 2.0e-57 219.5
Mch3g1006 . 32 248 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 2.0e-57 219.5
Mch2g0724 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.0e-56 217.2
Mch8g2102 . 7 211 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.3e-56 216.9
Mch4g0334 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 1.6e-54 209.9
Mch10g1131 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 2.6e-52 202.6
Mch2g0724 . 1 268 Chloroplast and Mitochondria Gene Families AT2G34420 88.5 2.1e-136 481.9
Mch1g2002 . 44 308 Chloroplast and Mitochondria Gene Families AT2G34420 88.0 3.9e-135 477.6
Mch1g2004 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.0 3.9e-135 477.6
Mch3g1003 . 5 270 Chloroplast and Mitochondria Gene Families AT2G34420 88.1 3.9e-135 477.6
Mch3g1005 . 1 261 Chloroplast and Mitochondria Gene Families AT2G34420 87.5 1.8e-132 468.8
Mch3g1006 . 1 261 Chloroplast and Mitochondria Gene Families AT2G34420 87.1 1.5e-131 465.7
Mch4g0334 . 3 266 Chloroplast and Mitochondria Gene Families AT2G34420 76.9 1.1e-116 416.4
Mch8g2102 . 3 211 Chloroplast and Mitochondria Gene Families AT2G34420 92.9 3.8e-114 407.9
Mch10g1131 . 46 265 Chloroplast and Mitochondria Gene Families AT2G34420 75.6 1.5e-94 342.8
Mch3g1003 . 5 270 Chloroplast and Mitochondria Gene Families AT2G34430 88.0 4.2e-137 484.2
Mch1g2002 . 44 308 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 1.2e-136 482.6
Mch1g2004 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 1.2e-136 482.6
Mch2g0724 . 1 268 Chloroplast and Mitochondria Gene Families AT2G34430 87.4 7.9e-136 479.9
Mch3g1005 . 1 261 Chloroplast and Mitochondria Gene Families AT2G34430 87.0 4.3e-134 474.2
Mch3g1006 . 1 261 Chloroplast and Mitochondria Gene Families AT2G34430 86.6 3.7e-133 471.1
Mch4g0334 . 31 266 Chloroplast and Mitochondria Gene Families AT2G34430 83.3 7.7e-115 410.2
Mch8g2102 . 3 211 Chloroplast and Mitochondria Gene Families AT2G34430 92.9 5.0e-114 407.5
Mch10g1131 . 46 265 Chloroplast and Mitochondria Gene Families AT2G34430 75.6 2.0e-94 342.4
Mch1g0627 . 1 287 Chloroplast and Mitochondria Gene Families AT5G01530 84.5 5.2e-141 497.3
Mch10g0618 . 53 313 Chloroplast and Mitochondria Gene Families AT5G40810 93.1 2.9e-143 504.6
Mch10g0618 . 6 313 Chloroplast and Mitochondria Gene Families AT3G27240 85.2 3.2e-149 524.6
Mch2g0813 . 7 328 Chloroplast and Mitochondria Gene Families AT2G30160 75.2 8.8e-145 510.0
Mch2g0813 . 7 328 Chloroplast and Mitochondria Gene Families AT1G07030 76.0 2.5e-144 508.4
Mch9g0693 . 1 308 Chloroplast and Mitochondria Gene Families AT2G47490 76.6 1.1e-136 483.0
Mch4g1352 . 17 316 Chloroplast and Mitochondria Gene Families AT2G47490 64.0 3.7e-108 388.3
Mch4g1352 . 17 365 Chloroplast and Mitochondria Gene Families AT1G25380 63.4 3.7e-120 428.3
Mch9g0693 . 11 297 Chloroplast and Mitochondria Gene Families AT1G25380 65.2 8.0e-107 384.0
Mch3g1172 . 6 564 Chloroplast and Mitochondria Gene Families AT4G21490 75.9 2.7e-250 861.3
Mch2g0589 . 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 70.0 7.5e-240 826.6
Mch4g0180 . 7 552 Chloroplast and Mitochondria Gene Families AT4G21490 65.3 2.3e-212 735.3
Mch9g1999 . 49 223 Chloroplast and Mitochondria Gene Families AT1G26100 70.9 1.3e-68 256.5
Mch4g2425 . 1 227 Chloroplast and Mitochondria Gene Families AT5G38630 69.7 9.7e-90 326.6
Mch6g2469 . 23 219 Chloroplast and Mitochondria Gene Families AT4G25570 70.1 1.9e-79 292.7
Mch4g1472 . 5 222 Chloroplast and Mitochondria Gene Families AT1G14730 50.9 1.7e-62 236.1
Mch4g1596 . 11 369 Chloroplast and Mitochondria Gene Families AT5G14040 83.3 2.8e-171 598.2
Mch8g1355 . 10 370 Chloroplast and Mitochondria Gene Families AT5G14040 78.5 5.8e-161 563.9
Mch6g0021 . 8 331 Chloroplast and Mitochondria Gene Families AT5G14040 74.8 2.8e-147 518.5
Mch4g0389 . 11 292 Chloroplast and Mitochondria Gene Families AT5G14040 52.4 7.6e-84 307.8
Mch4g1596 . 8 363 Chloroplast and Mitochondria Gene Families AT3G48850 71.8 1.6e-147 519.2
Mch8g1355 . 11 373 Chloroplast and Mitochondria Gene Families AT3G48850 70.7 3.0e-146 515.0
Mch6g0021 . 6 331 Chloroplast and Mitochondria Gene Families AT3G48850 68.5 2.2e-133 472.2
Mch4g0389 . 11 292 Chloroplast and Mitochondria Gene Families AT3G48850 51.4 1.2e-83 307.0
Mch4g0389 . 8 291 Chloroplast and Mitochondria Gene Families AT2G17270 76.5 6.4e-129 457.2
Mch8g1355 . 71 362 Chloroplast and Mitochondria Gene Families AT2G17270 53.1 1.3e-86 316.6
Mch4g1596 . 62 363 Chloroplast and Mitochondria Gene Families AT2G17270 51.7 1.1e-85 313.5
Mch6g0021 . 47 330 Chloroplast and Mitochondria Gene Families AT2G17270 50.2 1.6e-79 293.1
Mch4g2377 . 9 308 Chloroplast and Mitochondria Gene Families AT5G15640 77.4 3.2e-128 454.9
Mch11g0440 . 12 345 Chloroplast and Mitochondria Gene Families AT5G26200 68.6 2.3e-124 442.2
Mch9g0233 . 5 348 Chloroplast and Mitochondria Gene Families AT5G26200 59.4 3.6e-109 391.7
Mch9g0233 . 5 352 Chloroplast and Mitochondria Gene Families AT1G72820 76.6 2.4e-148 521.9
Mch11g0440 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 68.5 9.4e-129 456.8
Mch6g2417 . 80 284 Chloroplast and Mitochondria Gene Families AT5G52570 52.2 1.1e-48 190.3
Mch10g0128 . 1 253 Chloroplast and Mitochondria Gene Families AT4G25700 56.2 4.7e-65 244.6
Mch6g2417 . 72 201 Chloroplast and Mitochondria Gene Families AT4G25700 75.4 8.3e-54 207.2
Mch10g1129 . 48 334 Chloroplast and Mitochondria Gene Families AT5G54290 78.9 9.6e-121 430.3
Mch6g0568 . 35 547 Chloroplast and Mitochondria Gene Families AT2G18710 83.9 9.0e-243 836.3
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0000158 13 5 7 13 5 6 0 6 5 5 5 5 10 6 7 9 5 6 7 6 6 18 5 5 6 7 8 8 5 2 201