Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Mch5g1759 ATGAGCGTGATCGACCTTTTGACCAGAGTAGACGCGATCTGCCAGAAGTATGACAAGTACGATGTAGAGAAGCAGAGGGATCTCAATGTCTCCGGCGACGACGCCTTCGCTCGACTCTATGCAACCGTCGAAGCCGACATTGAAGCCGCTCTCCAGAAAGCGGAGGATGCTTCCAAAGAGAAGAATAGGGCATCGGTGGTGGCGTTGAATGCGGAGATTCGTCGTACTAAGGCTCGATTACTGGAGGAGGTCCCCAAGTTGCAGAGATTGGCCGTGAAGAGGGTAAAAGGGCTATCAACGGAAGATCTTACTACTCGAAATGATTTGGTGCTTGCATTGCCGGATAGGATTCAAGCTATACCAGATGGGACTACCACTGCAACCAAGAAGACTGGGGGTTGGACATCCTCAGCTTCACGTACTGATATAAAATTTGACTCAGATGGACGATTCGATGATGAATACTTCCAACACACCGAGGAGTCAAGTCAGTTCAGGCAAGAGTATGAAATGCGGAAAATGAAACAGGATCAAGGATTGGACATGATATCAGAAGGGTTGGATACTCTGAAGAACATGGCTCATGATATGAATGAGGAAATAGATAGGCAAGTTCCTTTGATGGACGAGATTGACACTAAGGTGGACAAGGCTGCATCTGACCTTAAGAACACCAATGTTAGATTAAAGCACACAGTTAATCAGCTAAGGTCCAGCAGAAATTTCTGTATTGATATTGTTTTGTTGTGTATAATCTTGGGTATTGCTGCCTATCTATACAAGCTTGGCTTCTTGTCAAATGTGCAATCAATGGGGCTTCCTCTTTTGGAGGTGATGGTGATTGGGAATTACAATATTATCCTGGGGAATGACCTTGAGATTGGT 885 45.42 MSVIDLLTRVDAICQKYDKYDVEKQRDLNVSGDDAFARLYATVEADIEAALQKAEDASKEKNRASVVALNAEIRRTKARLLEEVPKLQRLAVKRVKGLSTEDLTTRNDLVLALPDRIQAIPDGTTTATKKTGGWTSSASRTDIKFDSDGRFDDEYFQHTEESSQFRQEYEMRKMKQDQGLDMISEGLDTLKNMAHDMNEEIDRQVPLMDEIDTKVDKAASDLKNTNVRLKHTVNQLRSSRNFCIDIVLLCIILGIAAYLYKLGFLSNVQSMGLPLLEVMVIGNYNIILGNDLEIG 295
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
5 18170087 18172386 - MC05g1400 Mch5g1759 689178

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Mch5g1759 295 Coils Coil 40 60 - -
Mch5g1759 295 Pfam SNARE domain 207 256 IPR000727 -
Mch5g1759 295 FunFam Putative syntaxin-71-like 170 231 - -
Mch5g1759 295 SMART tSNARE_6 165 232 IPR000727 -
Mch5g1759 295 ProSitePatterns Syntaxin / epimorphin family signature. 176 215 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Mch5g1759 295 Gene3D - 170 231 - -
Mch5g1759 295 SUPERFAMILY SNARE fusion complex 163 230 - -
Mch5g1759 295 PANTHER SYNTAXIN 44 250 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0006886(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Mch5g1759 295 CDD SNARE_Qc 175 231 - -
Mch5g1759 295 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 170 232 IPR000727 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Mch5g1759 K08506 - - csv:101215905 489.96
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Mch2g0282 Mch-Chr2:2113563 Mch5g1759 Mch-Chr5:18170087 4.42E-117 dispersed
Mch2g0362 Mch-Chr2:2702939 Mch5g1759 Mch-Chr5:18170087 1.39E-118 wgd
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Mch8g0402 . 8 342 SNARE and Associated Proteins AT3G24350 66.1 2.2e-104 375.9
Mch1g0568 . 39 346 SNARE and Associated Proteins AT1G08560 66.2 2.5e-101 365.5
Mch1g1511 . 450 751 SNARE and Associated Proteins AT2G18260 53.7 5.2e-83 304.7
Mch5g1533 . 19 279 SNARE and Associated Proteins AT3G11820 82.4 1.5e-117 419.5
Mch1g0981 . 21 280 SNARE and Associated Proteins AT3G11820 73.5 1.6e-103 372.9
Mch3g1169 . 31 281 SNARE and Associated Proteins AT3G11820 64.9 1.1e-91 333.6
Mch5g1220 . 25 277 SNARE and Associated Proteins AT3G11820 52.6 1.1e-67 253.8
Mch5g1533 . 1 279 SNARE and Associated Proteins AT3G52400 64.6 1.6e-93 339.7
Mch1g0981 . 32 280 SNARE and Associated Proteins AT3G52400 65.9 3.9e-87 318.5
Mch3g1169 . 1 281 SNARE and Associated Proteins AT3G52400 55.7 1.6e-80 296.6
Mch3g1169 . 1 299 SNARE and Associated Proteins AT4G03330 68.5 9.4e-109 390.2
Mch5g1533 . 1 280 SNARE and Associated Proteins AT4G03330 58.4 2.1e-84 309.3
Mch1g0981 . 1 286 SNARE and Associated Proteins AT4G03330 51.9 3.3e-77 285.4
Mch3g1169 . 1 303 SNARE and Associated Proteins AT1G61290 77.9 4.0e-128 454.5
Mch5g1533 . 1 280 SNARE and Associated Proteins AT1G61290 62.4 1.0e-91 333.6
Mch1g0981 . 1 292 SNARE and Associated Proteins AT1G61290 55.5 3.0e-83 305.4
Mch3g1169 . 1 303 SNARE and Associated Proteins AT1G11250 76.9 3.1e-125 444.9
Mch5g1533 . 1 280 SNARE and Associated Proteins AT1G11250 62.9 3.8e-94 341.7
Mch1g0981 . 1 289 SNARE and Associated Proteins AT1G11250 56.4 2.4e-85 312.4
Mch5g1220 . 1 301 SNARE and Associated Proteins AT3G03800 73.4 2.8e-113 405.2
Mch2g0632 . 1 305 SNARE and Associated Proteins AT3G03800 57.5 4.0e-83 305.1
Mch5g1220 . 1 195 SNARE and Associated Proteins AT5G08080 77.5 3.7e-78 288.1
Mch2g0632 . 1 204 SNARE and Associated Proteins AT5G08080 60.3 6.3e-54 207.6
Mch10g1680 . 1 256 SNARE and Associated Proteins AT5G16830 58.8 1.4e-74 276.6
Mch10g1680 . 1 256 SNARE and Associated Proteins AT5G46860 66.0 2.3e-79 292.4
Mch10g1680 . 1 256 SNARE and Associated Proteins AT4G17730 61.7 1.4e-73 273.1
Mch10g1680 . 65 256 SNARE and Associated Proteins AT1G32270 60.9 6.3e-53 204.9
Mch9g1485 . 1 334 SNARE and Associated Proteins AT5G05760 66.3 5.9e-112 401.0
Mch8g0402 . 8 342 SNARE and Associated Proteins AT3G24350 66.1 2.2e-104 375.9
Mch8g2794 . 1 327 SNARE and Associated Proteins AT5G26980 76.5 1.6e-127 452.6
Mch9g0690 . 1 319 SNARE and Associated Proteins AT5G26980 67.9 1.8e-105 379.4
Mch11g1612 . 1 114 SNARE and Associated Proteins AT5G26980 70.4 1.7e-36 150.2
Mch8g2794 . 1 330 SNARE and Associated Proteins AT4G02195 65.4 7.1e-107 384.0
Mch9g0690 . 1 319 SNARE and Associated Proteins AT4G02195 67.1 1.2e-106 383.3
Mch8g2794 . 1 328 SNARE and Associated Proteins AT3G05710 75.4 4.4e-128 454.5
Mch9g0690 . 1 322 SNARE and Associated Proteins AT3G05710 64.2 1.0e-100 363.6
Mch11g1220 . 1 226 SNARE and Associated Proteins AT1G16240 69.2 5.7e-82 300.8
Mch11g1220 . 1 226 SNARE and Associated Proteins AT1G79590 68.4 1.4e-81 299.7
Mch11g1194 . 56 247 SNARE and Associated Proteins AT1G28490 71.4 1.1e-65 246.5
Mch5g1759 . 1 261 SNARE and Associated Proteins AT3G09740 79.5 6.7e-111 397.1
Mch2g0282 . 1 261 SNARE and Associated Proteins AT3G09740 66.3 1.9e-89 325.9
Mch2g0362 . 1 262 SNARE and Associated Proteins AT3G09740 65.7 3.2e-89 325.1
Mch5g1759 . 1 261 SNARE and Associated Proteins AT3G45280 64.0 1.2e-86 316.6
Mch2g0362 . 1 262 SNARE and Associated Proteins AT3G45280 63.4 1.3e-82 303.1
Mch2g0282 . 1 261 SNARE and Associated Proteins AT3G45280 63.6 2.3e-82 302.4
Mch5g1759 . 1 261 SNARE and Associated Proteins AT3G61450 67.8 6.6e-95 344.0
Mch2g0362 . 1 262 SNARE and Associated Proteins AT3G61450 57.2 8.7e-79 290.4
Mch2g0282 . 1 261 SNARE and Associated Proteins AT3G61450 57.4 2.5e-78 288.9
Mch4g2528 . 65 303 SNARE and Associated Proteins AT1G51740 72.4 4.6e-90 327.8
Mch11g1356 . 39 217 SNARE and Associated Proteins AT1G51740 68.5 4.8e-55 211.5
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002038 1 2 1 1 1 2 3 2 2 2 2 2 3 3 2 3 2 2 3 2 3 2 2 2 2 2 3 2 2 2 63