Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Sed01g0708 ATGAAATTCCAAGACCATAACCAGAATCAATACTCCCAACAGATATGCAGAACTATTGAGATCGATACAATCAATCCCCACCGCACTGTTTCGCCGCCGGTCGTAATGGAAGCTTCTGATGACGGCGACGGCCTCTACATCCCTCCTCTCAACTTCTCCATGGTTGATAATGCCGTTTTCCGCTCCGGCTTCCCTGATCCTGCTAACTTCTCCTTCCTCCAAACCCTAGGCCTCCGTTCCATTATATGTTTATGCCCGGAGCCGTATCCTGAGCACAACATGGAGTTTCTCAAGTCTAACGGGATTCGATTGTATCAATTTGGAATTGAAAGCTACAAGGAGCCTTTCGTGAACATCCCAGATAATATGATTCGTGAAGCACTGAAAGTTGTCCTTGACGATAGGAACCATCCAGTTCTCATACATTGCAAGAGAGGAAAGCATCGAACAGGTTGCCTTGTGGGATGCCTGAGAAAACTGCAAAAGTGGTGCCTCACTTCTGTGTTTGATGAGTACCAGAGGTTTGCAGCTGCAAAAGCAAGAATTTCAGACCAGAGGTTTATGGAATTGTTCGACATCTCTGACTTGAAGCATCTTCCCATGTCATTCTCATGCTCTAAGAGGTGA 627 46.09 MKFQDHNQNQYSQQICRTIEIDTINPHRTVSPPVVMEASDDGDGLYIPPLNFSMVDNAVFRSGFPDPANFSFLQTLGLRSIICLCPEPYPEHNMEFLKSNGIRLYQFGIESYKEPFVNIPDNMIREALKVVLDDRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLTSVFDEYQRFAAAKARISDQRFMELFDISDLKHLPMSFSCSKR 208
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
1 5188054 5192033 - Sed0018332.1 Sed01g0708 700012

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Sed01g0708 208 ProSiteProfiles Dual specificity protein phosphatase domain profile. 51 205 IPR020422 GO:0006470(InterPro)
Sed01g0708 208 FunFam probable tyrosine-protein phosphatase At1g05000 45 195 - -
Sed01g0708 208 ProSitePatterns Tyrosine specific protein phosphatases active site. 141 151 IPR016130 GO:0016311(InterPro)
Sed01g0708 208 Gene3D Protein tyrosine phosphatase superfamily 46 195 IPR029021 -
Sed01g0708 208 Pfam Tyrosine phosphatase family 46 198 IPR004861 -
Sed01g0708 208 PANTHER TYROSINE-PROTEIN PHOSPHATASE 22 201 - GO:0005737(PANTHER)|GO:0016791(PANTHER)
Sed01g0708 208 ProSiteProfiles Tyrosine specific protein phosphatases domain profile. 114 154 IPR000387 GO:0016311(InterPro)
Sed01g0708 208 PRINTS Plant and fungal dual specificity phosphatase signature 46 63 IPR020428 GO:0016791(InterPro)
Sed01g0708 208 PRINTS Plant and fungal dual specificity phosphatase signature 119 133 IPR020428 GO:0016791(InterPro)
Sed01g0708 208 PRINTS Plant and fungal dual specificity phosphatase signature 102 116 IPR020428 GO:0016791(InterPro)
Sed01g0708 208 PRINTS Plant and fungal dual specificity phosphatase signature 83 96 IPR020428 GO:0016791(InterPro)
Sed01g0708 208 SUPERFAMILY (Phosphotyrosine protein) phosphatases II 47 193 IPR029021 -
Sed01g0708 208 CDD PFA-DSP_Siw14 45 192 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Sed01g0708 K18045 - - csv:101222170 364.385
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Sed01g0708 Sed-Chr1:5188054 Sed05g1893 Sed-Chr5:32353316 2.70E-84 dispersed
Sed06g0972 Sed-Chr6:13290970 Sed01g0708 Sed-Chr1:5188054 7.80E-57 transposed
Sed08g1212 Sed-Chr8:25021100 Sed01g0708 Sed-Chr1:5188054 4.10E-58 transposed
Sed01g0708 Sed-Chr1:5188054 Sed04g3433 Sed-Chr4:44101419 4.90E-78 wgd
Sed01g0708 Sed-Chr1:5188054 Sed05g3223 Sed-Chr5:41876659 2.30E-104 wgd
Sed01g0708 Sed-Chr1:5188054 Sed05g1892 Sed-Chr5:32353316 8.90E-80 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi12g443 . . . . Bpe12g00275 Bpe15g00169 Bma03g01308 Bma08g00533 . . Cma02g00065 Cma20g00235 Car02g00052 Car20g00205 Sed05g1894 . . Bhi05g02097 Tan02g0134 Cmetu05g0487 . . . . Cla02g01771 Cam02g1872 Cec02g1896 Cco02g1936 Clacu02g1854 Cmu02g1800 . . Cone10ag1396 Cone8ag1552 . Lsi10g01569 . Chy11g00950 . Blo04g01214 Blo13g00337 . Bda15g00865 Bpe14g00621 . . . Sed01g0708 Cmo02g00063 Cmo20g00254 . . Car11g01620 . Cpe16g00749 . Bhi10g01060 Tan05g0690 Cmetu11g0212 . Hepe08g0587 . . . . . . . . . Lsi11g01669 Csa06g02393 . Cme11g01505
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Sed10g0663 . 33 605 Protein tyrosine phosphatase (PTP) family AT3G50110 60.9 5.5e-189 658.7
Sed10g0664 . 33 605 Protein tyrosine phosphatase (PTP) family AT3G50110 60.9 5.5e-189 658.7
Sed10g1999 . 20 610 Protein tyrosine phosphatase (PTP) family AT3G50110 56.5 1.2e-180 630.9
Sed14g0871 . 33 595 Protein tyrosine phosphatase (PTP) family AT3G50110 58.7 6.1e-180 628.6
Sed05g2595 . 42 611 Protein tyrosine phosphatase (PTP) family AT3G50110 56.5 1.8e-176 617.1
Sed05g2596 . 42 611 Protein tyrosine phosphatase (PTP) family AT3G50110 56.5 1.8e-176 617.1
Sed05g2597 . 42 611 Protein tyrosine phosphatase (PTP) family AT3G50110 56.5 1.8e-176 617.1
Sed05g2598 . 42 611 Protein tyrosine phosphatase (PTP) family AT3G50110 56.5 1.8e-176 617.1
Sed14g0872 . 33 631 Protein tyrosine phosphatase (PTP) family AT3G50110 52.6 7.0e-160 562.0
Sed14g0873 . 33 417 Protein tyrosine phosphatase (PTP) family AT3G50110 70.0 5.0e-158 555.8
Sed10g0665 . 1 460 Protein tyrosine phosphatase (PTP) family AT3G50110 61.5 3.0e-155 546.6
Sed04g3520 . 1 406 Protein tyrosine phosphatase (PTP) family AT5G39400 65.7 4.4e-155 545.4
Sed01g2862 . 1 854 Protein tyrosine phosphatase (PTP) family AT3G10550 69.3 0.0e+00 1172.5
Sed03g0609 . 1 868 Protein tyrosine phosphatase (PTP) family AT3G10550 66.7 0.0e+00 1142.9
Sed01g2863 . 3 764 Protein tyrosine phosphatase (PTP) family AT3G10550 70.0 2.6e-311 1065.4
Sed01g2862 . 1 854 Protein tyrosine phosphatase (PTP) family AT5G04540 65.6 0.0e+00 1110.1
Sed03g0609 . 1 868 Protein tyrosine phosphatase (PTP) family AT5G04540 63.5 6.8e-314 1073.5
Sed01g2863 . 4 764 Protein tyrosine phosphatase (PTP) family AT5G04540 66.7 2.0e-295 1012.7
Sed12g2294 . 1 1135 Protein tyrosine phosphatase (PTP) family AT5G58160 52.9 0.0e+00 1083.9
Sed05g1740 . 1 1349 Protein tyrosine phosphatase (PTP) family AT5G58160 51.0 1.0e-303 1040.8
Sed05g1741 . 1 1289 Protein tyrosine phosphatase (PTP) family AT5G58160 50.5 3.9e-279 959.1
Sed10g1774 . 75 390 Protein tyrosine phosphatase (PTP) family AT1G71860 66.6 7.6e-121 431.4
Sed12g2546 . 27 937 Protein tyrosine phosphatase (PTP) family AT5G23720 60.5 8.3e-287 984.2
Sed04g1865 . 33 172 Protein tyrosine phosphatase (PTP) family AT3G06110 57.1 7.8e-42 167.9
Sed04g1863 . 33 172 Protein tyrosine phosphatase (PTP) family AT3G06110 57.1 7.8e-42 167.9
Sed04g3441 . 1 166 Protein tyrosine phosphatase (PTP) family AT2G04550 78.1 7.7e-72 267.7
Sed04g3442 . 1 166 Protein tyrosine phosphatase (PTP) family AT2G04550 78.1 7.7e-72 267.7
Sed05g1887 . 1 166 Protein tyrosine phosphatase (PTP) family AT2G04550 76.3 2.5e-70 262.7
Sed06g2006 . 103 384 Protein tyrosine phosphatase (PTP) family AT3G52180 69.9 2.0e-114 409.8
Sed07g2221 . 94 378 Protein tyrosine phosphatase (PTP) family AT3G52180 69.5 1.7e-113 406.8
Sed07g2222 . 94 378 Protein tyrosine phosphatase (PTP) family AT3G52180 69.5 1.7e-113 406.8
Sed04g0349 . 5 284 Protein tyrosine phosphatase (PTP) family AT3G10940 65.7 1.2e-106 384.0
Sed06g0547 . 146 594 Protein tyrosine phosphatase (PTP) family AT3G01510 71.9 2.4e-199 692.6
Sed06g0548 . 2 450 Protein tyrosine phosphatase (PTP) family AT3G01510 71.9 2.4e-199 692.6
Sed01g0708 . 8 208 Protein tyrosine phosphatase (PTP) family AT2G32960 58.6 5.3e-74 275.4
Sed05g1892 . 38 234 Protein tyrosine phosphatase (PTP) family AT2G32960 65.8 7.7e-73 271.6
Sed04g3433 . 6 238 Protein tyrosine phosphatase (PTP) family AT2G32960 56.8 1.0e-72 271.2
Sed05g3223 . 10 212 Protein tyrosine phosphatase (PTP) family AT2G32960 59.8 1.3e-72 270.8
Sed05g1893 . 38 204 Protein tyrosine phosphatase (PTP) family AT2G32960 64.9 5.5e-71 265.4
Sed04g1684 . 1 333 Protein tyrosine phosphatase (PTP) family AT2G35680 55.1 4.8e-99 359.0
Sed03g1757 . 17 263 Protein tyrosine phosphatase (PTP) family AT2G35680 54.2 2.7e-78 290.0
Sed03g1757 . 27 218 Protein tyrosine phosphatase (PTP) family AT5G56610 51.0 4.4e-46 182.2
Sed01g0708 . 18 208 Protein tyrosine phosphatase (PTP) family AT4G03960 70.2 1.5e-76 283.5
Sed05g3223 . 25 212 Protein tyrosine phosphatase (PTP) family AT4G03960 71.3 1.7e-75 280.0
Sed05g1893 . 34 204 Protein tyrosine phosphatase (PTP) family AT4G03960 75.4 1.8e-74 276.6
Sed05g1892 . 34 234 Protein tyrosine phosphatase (PTP) family AT4G03960 64.2 1.0e-69 260.8
Sed04g3433 . 39 238 Protein tyrosine phosphatase (PTP) family AT4G03960 63.0 5.2e-69 258.5
Sed08g1212 . 5 171 Protein tyrosine phosphatase (PTP) family AT4G03960 59.9 8.6e-56 214.5
Sed06g0972 . 14 183 Protein tyrosine phosphatase (PTP) family AT4G03960 56.1 2.3e-53 206.5
Sed08g1212 . 1 200 Protein tyrosine phosphatase (PTP) family AT3G02800 67.0 4.0e-77 285.4
Sed06g0972 . 3 196 Protein tyrosine phosphatase (PTP) family AT3G02800 65.6 1.2e-73 273.9
Sed01g0708 . 34 202 Protein tyrosine phosphatase (PTP) family AT3G02800 58.6 4.7e-57 218.8
Sed05g3223 . 43 209 Protein tyrosine phosphatase (PTP) family AT3G02800 60.5 5.1e-56 215.3
Sed05g1893 . 40 193 Protein tyrosine phosphatase (PTP) family AT3G02800 63.0 8.8e-56 214.5
Sed05g1892 . 40 223 Protein tyrosine phosphatase (PTP) family AT3G02800 52.7 5.0e-51 198.7
Sed04g3433 . 44 227 Protein tyrosine phosphatase (PTP) family AT3G02800 51.1 1.6e-49 193.7
Sed07g2453 . 1 189 Protein tyrosine phosphatase (PTP) family AT3G55270 65.3 1.5e-63 242.3
Sed04g2798 . 20 188 Protein tyrosine phosphatase (PTP) family AT3G55270 67.1 4.5e-60 230.7
Sed04g2799 . 20 188 Protein tyrosine phosphatase (PTP) family AT3G55270 67.1 4.5e-60 230.7
Sed04g3520 . 1 406 Protein tyrosine phosphatase (PTP) family AT5G39400 65.7 4.4e-155 545.4
Sed05g2595 . 32 611 Protein tyrosine phosphatase (PTP) family AT3G19420 65.3 4.6e-217 751.9
Sed05g2596 . 32 611 Protein tyrosine phosphatase (PTP) family AT3G19420 65.3 4.6e-217 751.9
Sed05g2597 . 32 611 Protein tyrosine phosphatase (PTP) family AT3G19420 65.3 4.6e-217 751.9
Sed05g2598 . 32 611 Protein tyrosine phosphatase (PTP) family AT3G19420 65.3 4.6e-217 751.9
Sed10g1999 . 8 610 Protein tyrosine phosphatase (PTP) family AT3G19420 63.5 7.8e-217 751.1
Sed10g0663 . 31 605 Protein tyrosine phosphatase (PTP) family AT3G19420 62.5 3.9e-200 695.7
Sed10g0664 . 31 605 Protein tyrosine phosphatase (PTP) family AT3G19420 62.5 3.9e-200 695.7
Sed14g0871 . 33 595 Protein tyrosine phosphatase (PTP) family AT3G19420 59.5 4.8e-190 662.1
Sed14g0872 . 33 631 Protein tyrosine phosphatase (PTP) family AT3G19420 53.6 1.9e-170 597.0
Sed14g0873 . 33 419 Protein tyrosine phosphatase (PTP) family AT3G19420 70.9 8.2e-166 581.6
Sed10g0665 . 1 460 Protein tyrosine phosphatase (PTP) family AT3G19420 64.1 3.1e-165 579.7
Sed10g0663 . 33 605 Protein tyrosine phosphatase (PTP) family AT3G50110 60.9 5.5e-189 658.7
Sed10g0664 . 33 605 Protein tyrosine phosphatase (PTP) family AT3G50110 60.9 5.5e-189 658.7
Sed10g1999 . 20 610 Protein tyrosine phosphatase (PTP) family AT3G50110 56.5 1.2e-180 630.9
Sed14g0871 . 33 595 Protein tyrosine phosphatase (PTP) family AT3G50110 58.7 6.1e-180 628.6
Sed05g2595 . 42 611 Protein tyrosine phosphatase (PTP) family AT3G50110 56.5 1.8e-176 617.1
Sed05g2596 . 42 611 Protein tyrosine phosphatase (PTP) family AT3G50110 56.5 1.8e-176 617.1
Sed05g2597 . 42 611 Protein tyrosine phosphatase (PTP) family AT3G50110 56.5 1.8e-176 617.1
Sed05g2598 . 42 611 Protein tyrosine phosphatase (PTP) family AT3G50110 56.5 1.8e-176 617.1
Sed14g0872 . 33 631 Protein tyrosine phosphatase (PTP) family AT3G50110 52.6 7.0e-160 562.0
Sed14g0873 . 33 417 Protein tyrosine phosphatase (PTP) family AT3G50110 70.0 5.0e-158 555.8
Sed10g0665 . 1 460 Protein tyrosine phosphatase (PTP) family AT3G50110 61.5 3.0e-155 546.6
Sed12g2294 . 1 1135 Protein tyrosine phosphatase (PTP) family AT5G58160 52.9 0.0e+00 1083.9
Sed05g1740 . 1 1349 Protein tyrosine phosphatase (PTP) family AT5G58160 51.0 1.0e-303 1040.8
Sed05g1741 . 1 1289 Protein tyrosine phosphatase (PTP) family AT5G58160 50.5 3.9e-279 959.1
Sed01g2862 . 1 854 Protein tyrosine phosphatase (PTP) family AT3G10550 69.3 0.0e+00 1172.5
Sed03g0609 . 1 868 Protein tyrosine phosphatase (PTP) family AT3G10550 66.7 0.0e+00 1142.9
Sed01g2863 . 3 764 Protein tyrosine phosphatase (PTP) family AT3G10550 70.0 2.6e-311 1065.4
Sed01g2862 . 1 854 Protein tyrosine phosphatase (PTP) family AT5G04540 65.6 0.0e+00 1110.1
Sed03g0609 . 1 868 Protein tyrosine phosphatase (PTP) family AT5G04540 63.5 6.8e-314 1073.5
Sed01g2863 . 4 764 Protein tyrosine phosphatase (PTP) family AT5G04540 66.7 2.0e-295 1012.7
Sed05g1208 . 64 244 Protein tyrosine phosphatase (PTP) family AT3G44620 63.9 9.9e-68 254.6
Sed05g1209 . 64 172 Protein tyrosine phosphatase (PTP) family AT3G44620 73.6 8.7e-40 161.8
Sed04g0821 . 24 319 Protein tyrosine phosphatase (PTP) family AT2G35320 62.5 3.6e-109 392.5
Sed04g0822 . 24 319 Protein tyrosine phosphatase (PTP) family AT2G35320 62.5 3.6e-109 392.5
Sed14g0659 . 1 674 Protein tyrosine phosphatase (PTP) family AT3G09100 70.8 4.3e-285 978.0
Sed14g0660 . 1 674 Protein tyrosine phosphatase (PTP) family AT3G09100 70.8 4.3e-285 978.0
Sed14g0659 . 5 674 Protein tyrosine phosphatase (PTP) family AT5G01290 65.4 1.9e-256 882.9
Sed14g0660 . 5 674 Protein tyrosine phosphatase (PTP) family AT5G01290 65.4 1.9e-256 882.9
Sed14g0659 . 78 674 Protein tyrosine phosphatase (PTP) family AT5G28210 57.2 2.3e-187 653.3
Sed14g0660 . 78 674 Protein tyrosine phosphatase (PTP) family AT5G28210 57.2 2.3e-187 653.3
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0001007 2 3 3 4 3 2 4 2 2 2 2 2 4 2 2 4 2 4 4 1 2 2 2 2 2 2 2 7 6 2 83