Gene search
Sequence information

Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
---|---|---|---|---|---|---|
Sed01g0708 | ATGAAATTCCAAGACCATAACCAGAATCAATACTCCCAACAGATATGCAGAACTATTGAGATCGATACAATCAATCCCCACCGCACTGTTTCGCCGCCGGTCGTAATGGAAGCTTCTGATGACGGCGACGGCCTCTACATCCCTCCTCTCAACTTCTCCATGGTTGATAATGCCGTTTTCCGCTCCGGCTTCCCTGATCCTGCTAACTTCTCCTTCCTCCAAACCCTAGGCCTCCGTTCCATTATATGTTTATGCCCGGAGCCGTATCCTGAGCACAACATGGAGTTTCTCAAGTCTAACGGGATTCGATTGTATCAATTTGGAATTGAAAGCTACAAGGAGCCTTTCGTGAACATCCCAGATAATATGATTCGTGAAGCACTGAAAGTTGTCCTTGACGATAGGAACCATCCAGTTCTCATACATTGCAAGAGAGGAAAGCATCGAACAGGTTGCCTTGTGGGATGCCTGAGAAAACTGCAAAAGTGGTGCCTCACTTCTGTGTTTGATGAGTACCAGAGGTTTGCAGCTGCAAAAGCAAGAATTTCAGACCAGAGGTTTATGGAATTGTTCGACATCTCTGACTTGAAGCATCTTCCCATGTCATTCTCATGCTCTAAGAGGTGA | 627 | 46.09 | MKFQDHNQNQYSQQICRTIEIDTINPHRTVSPPVVMEASDDGDGLYIPPLNFSMVDNAVFRSGFPDPANFSFLQTLGLRSIICLCPEPYPEHNMEFLKSNGIRLYQFGIESYKEPFVNIPDNMIREALKVVLDDRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLTSVFDEYQRFAAAKARISDQRFMELFDISDLKHLPMSFSCSKR | 208 |
Gff information

Chromosome | Start | End | Strand | Old_gene | Gene | Num |
---|---|---|---|---|---|---|
1 | 5188054 | 5192033 | - | Sed0018332.1 | Sed01g0708 | 700012 |
Annotation information

Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
---|---|---|---|---|---|---|---|---|
Sed01g0708 | 208 | ProSiteProfiles | Dual specificity protein phosphatase domain profile. | 51 | 205 | IPR020422 | GO:0006470(InterPro) | |
Sed01g0708 | 208 | FunFam | probable tyrosine-protein phosphatase At1g05000 | 45 | 195 | - | - | |
Sed01g0708 | 208 | ProSitePatterns | Tyrosine specific protein phosphatases active site. | 141 | 151 | IPR016130 | GO:0016311(InterPro) | |
Sed01g0708 | 208 | Gene3D | Protein tyrosine phosphatase superfamily | 46 | 195 | IPR029021 | - | |
Sed01g0708 | 208 | Pfam | Tyrosine phosphatase family | 46 | 198 | IPR004861 | - | |
Sed01g0708 | 208 | PANTHER | TYROSINE-PROTEIN PHOSPHATASE | 22 | 201 | - | GO:0005737(PANTHER)|GO:0016791(PANTHER) | |
Sed01g0708 | 208 | ProSiteProfiles | Tyrosine specific protein phosphatases domain profile. | 114 | 154 | IPR000387 | GO:0016311(InterPro) | |
Sed01g0708 | 208 | PRINTS | Plant and fungal dual specificity phosphatase signature | 46 | 63 | IPR020428 | GO:0016791(InterPro) | |
Sed01g0708 | 208 | PRINTS | Plant and fungal dual specificity phosphatase signature | 119 | 133 | IPR020428 | GO:0016791(InterPro) | |
Sed01g0708 | 208 | PRINTS | Plant and fungal dual specificity phosphatase signature | 102 | 116 | IPR020428 | GO:0016791(InterPro) | |
Sed01g0708 | 208 | PRINTS | Plant and fungal dual specificity phosphatase signature | 83 | 96 | IPR020428 | GO:0016791(InterPro) | |
Sed01g0708 | 208 | SUPERFAMILY | (Phosphotyrosine protein) phosphatases II | 47 | 193 | IPR029021 | - | |
Sed01g0708 | 208 | CDD | PFA-DSP_Siw14 | 45 | 192 | - | - |
Duplication type information

Select | Gene1 | Location1 | Gene2 | Location2 | E-value | Duplicated-type |
---|---|---|---|---|---|---|
Sed01g0708 | Sed-Chr1:5188054 | Sed05g1893 | Sed-Chr5:32353316 | 2.70E-84 | dispersed | |
Sed06g0972 | Sed-Chr6:13290970 | Sed01g0708 | Sed-Chr1:5188054 | 7.80E-57 | transposed | |
Sed08g1212 | Sed-Chr8:25021100 | Sed01g0708 | Sed-Chr1:5188054 | 4.10E-58 | transposed | |
Sed01g0708 | Sed-Chr1:5188054 | Sed04g3433 | Sed-Chr4:44101419 | 4.90E-78 | wgd | |
Sed01g0708 | Sed-Chr1:5188054 | Sed05g3223 | Sed-Chr5:41876659 | 2.30E-104 | wgd | |
Sed01g0708 | Sed-Chr1:5188054 | Sed05g1892 | Sed-Chr5:32353316 | 8.90E-80 | wgd |
Pathway information

Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
---|---|---|---|---|---|---|
Sed01g0708 | K18045 | - | csv:101222170 | 364.385 |