Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Sed01g1363 ATGAGCCGCCCGGGGGATTGGAATTGCAGGTCTTGCAACCATCTCAACTTTCAGCGGAGGGATTCGTGCCAGCGCTGTGGAGAGCCAAGGTCTGAATTCGGCGGCGGCGGATACGGCGGCGGAAGGGGCGGTTCCTCGTCGTTTGGGTTCACCACCGGCCCCGACGTTCGTCCTGGAGACTGGAACTGCGCCATTGCGAACTGCGGCGCTCACAACTTCGCCAGCCGCTCTAACTGCTTCAAGTGCGGCGCCGCTAAGGATGAGGCTTCCGCCGCCCACTACGACGGCGATTTCTCAAGAGTCAGAGCCTTTCATTCCGCCGCTGCCTCTAACCGCCCTGGATGGAAATCTGGTGATTGGATCTGTGCCAGATCGGATTGCAACGAGCATAACTTTGCCAGCCGAAGGGAGTGTTTCAGATGCAATGCGCCAAGGGATTCCAACAGCACGTCACCATACTTGTAG 465 58.92 MSRPGDWNCRSCNHLNFQRRDSCQRCGEPRSEFGGGGYGGGRGGSSSFGFTTGPDVRPGDWNCAIANCGAHNFASRSNCFKCGAAKDEASAAHYDGDFSRVRAFHSAAASNRPGWKSGDWICARSDCNEHNFASRRECFRCNAPRDSNSTSPYL 154
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
1 10143140 10145807 + Sed0001713.2 Sed01g1363 700667

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Sed01g1363 154 ProSitePatterns Zinc finger RanBP2-type signature. 61 82 IPR001876 -
Sed01g1363 154 SUPERFAMILY Ran binding protein zinc finger-like 2 32 IPR036443 -
Sed01g1363 154 PANTHER ZINC FINGER PROTEIN 56 149 - GO:0003729(PANTHER)|GO:0005737(PANTHER)
Sed01g1363 154 Gene3D - 108 148 - -
Sed01g1363 154 Gene3D - 52 89 - -
Sed01g1363 154 Gene3D - 2 32 - -
Sed01g1363 154 FunFam Ran-binding zinc finger protein 51 88 - -
Sed01g1363 154 SUPERFAMILY Ran binding protein zinc finger-like 53 88 IPR036443 -
Sed01g1363 154 ProSitePatterns Zinc finger RanBP2-type signature. 120 141 IPR001876 -
Sed01g1363 154 ProSiteProfiles Zinc finger RanBP2 type profile. 3 32 IPR001876 -
Sed01g1363 154 Pfam Zn-finger in Ran binding protein and others 3 30 IPR001876 -
Sed01g1363 154 Pfam Zn-finger in Ran binding protein and others 57 86 IPR001876 -
Sed01g1363 154 Pfam Zn-finger in Ran binding protein and others 116 145 IPR001876 -
Sed01g1363 154 FunFam Ran-binding zinc finger protein 110 147 - -
Sed01g1363 154 SUPERFAMILY Ran binding protein zinc finger-like 110 148 IPR036443 -
Sed01g1363 154 ProSiteProfiles Zinc finger RanBP2 type profile. 57 88 IPR001876 -
Sed01g1363 154 ProSitePatterns Zinc finger RanBP2-type signature. 7 26 IPR001876 -
Sed01g1363 154 ProSiteProfiles Zinc finger RanBP2 type profile. 116 147 IPR001876 -
Sed01g1363 154 SMART zf_4 59 85 IPR001876 -
Sed01g1363 154 SMART zf_4 5 29 IPR001876 -
Sed01g1363 154 SMART zf_4 118 144 IPR001876 -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Sed01g1363 - - - - 0.0
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Sed01g1363 Sed-Chr1:10143140 Sed03g1599 Sed-Chr3:10166087 4.10E-66 dispersed
Sed01g1362 Sed-Chr1:10143140 Sed01g1363 Sed-Chr1:10143140 9.80E-92 tandem
       

Deco-Alignment


Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi4g452 Blo01g01377 . Bda01g00734 . . Bpe02g00572 . . Cmo05g00409 Cmo12g00277 . Cma05g00396 . Car12g00309 Sed01g1363 Cpe07g00286 . Bhi04g00986 Tan02g2707 Cmetu03g1356 . . . Lcy13g1766 . . . . . . . Cone4ag1804 Cone7ag1712 . . . . . Cme03g01640 . . . . . . . . . . . . Cma12g00327 . Car05g00333 Cpe11g00340 . . . . . . . . Cla08g01315 Cam08g1775 Cec08g1357 Cco08g1477 Clacu08g1471 . Cre08g1258 Lsi08g01180 . Chy03g01140 .
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0001025 2 6 2 1 2 1 5 2 2 2 1 1 4 3 3 5 2 4 4 1 2 3 3 2 3 2 3 5 5 2 83