Gene search
Sequence information

Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
---|---|---|---|---|---|---|
Sed04g2542 | ATGCAGCTCTCAAGGACTTATGCCGCTACATCAGAGAAAAATGAAAAAAAGGTGAAGGTGCCACTTGCTTTGTTTGGAGGGTCTGGTAACTATGCCTCTGCTCTGTATATAGCTGCAGTAAAAGCTAATTCTCTTGGCAAGGTGGAGTCTGAGCTTGTTAACCTTGTCGATGCTATTAAGAAAAGTCCTACATTTGCTCAGTTCACAATGGACCTGTCAGTTCCAGCAGAAACTAGAGTTAAGGCTATCAATGAAATTTCTGCTGAAGCTAAATTTTCGGACGTTGTAAAGAACTTCTTGGTTGTTTTGGCTGAGAACGGGAGGCTGAGATATGCAGATAGCATAGCAAAGAGATTTTTGGAGTTGACTATGGCTCATAAGGGAGAACTTAAAGCAGTTGTTACTACTGTTATTCCCATTCCCCCACAAGAAGAGAAAGAATTGAAGGAGACATTGCAAGATATATTTGGACAAGGCAAGAAGGTTAAGCTCGAGCAGAAGATTGATCCCAGCATACTTGGTGGTCTAGTTGTAGAATTTGGCGAGAAAGTATTTGACATGTCTATCAAAACCCGTGCCCGTCAAATGGAGAGGTTCTTGCGCCAACCTGTTACTCTTGACTAG | 624 | 42.15 | MQLSRTYAATSEKNEKKVKVPLALFGGSGNYASALYIAAVKANSLGKVESELVNLVDAIKKSPTFAQFTMDLSVPAETRVKAINEISAEAKFSDVVKNFLVVLAENGRLRYADSIAKRFLELTMAHKGELKAVVTTVIPIPPQEEKELKETLQDIFGQGKKVKLEQKIDPSILGGLVVEFGEKVFDMSIKTRARQMERFLRQPVTLD | 207 |
Gff information

Chromosome | Start | End | Strand | Old_gene | Gene | Num |
---|---|---|---|---|---|---|
4 | 38225151 | 38229156 | - | Sed0003633.2 | Sed04g2542 | 711145 |
Annotation information

Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
---|---|---|---|---|---|---|---|---|
Sed04g2542 | 207 | NCBIfam | ATP synthase F1 subunit delta | 30 | 199 | IPR000711 | GO:0015986(InterPro)|GO:0046933(InterPro) | |
Sed04g2542 | 207 | PANTHER | ATP SYNTHASE DELTA CHAIN | 9 | 203 | IPR000711 | GO:0000274(PANTHER)|GO:0015986(InterPro)|GO:0015986(PANTHER)|GO:0042776(PANTHER)|GO:0045261(PANTHER)|GO:0046933(InterPro)|GO:0046933(PANTHER) | |
Sed04g2542 | 207 | Gene3D | - | 27 | 120 | IPR026015 | - | |
Sed04g2542 | 207 | ProSitePatterns | ATP synthase delta (OSCP) subunit signature. | 162 | 181 | IPR020781 | GO:0015986(InterPro)|GO:0016020(InterPro)|GO:0046933(InterPro) | |
Sed04g2542 | 207 | Pfam | ATP synthase delta (OSCP) subunit | 29 | 198 | IPR000711 | GO:0015986(InterPro)|GO:0046933(InterPro) | |
Sed04g2542 | 207 | SUPERFAMILY | N-terminal domain of the delta subunit of the F1F0-ATP synthase | 28 | 129 | IPR026015 | - | |
Sed04g2542 | 207 | Hamap | ATP synthase subunit delta [atpD]. | 23 | 202 | IPR000711 | GO:0015986(InterPro)|GO:0046933(InterPro) | |
Sed04g2542 | 207 | PRINTS | ATP synthase delta subunit signature | 160 | 175 | IPR000711 | GO:0015986(InterPro)|GO:0046933(InterPro) | |
Sed04g2542 | 207 | PRINTS | ATP synthase delta subunit signature | 175 | 193 | IPR000711 | GO:0015986(InterPro)|GO:0046933(InterPro) | |
Sed04g2542 | 207 | PRINTS | ATP synthase delta subunit signature | 108 | 122 | IPR000711 | GO:0015986(InterPro)|GO:0046933(InterPro) | |
Sed04g2542 | 207 | PRINTS | ATP synthase delta subunit signature | 27 | 46 | IPR000711 | GO:0015986(InterPro)|GO:0046933(InterPro) | |
Sed04g2542 | 207 | PRINTS | ATP synthase delta subunit signature | 97 | 108 | IPR000711 | GO:0015986(InterPro)|GO:0046933(InterPro) |
Duplication type information

Select | Gene1 | Location1 | Gene2 | Location2 | E-value | Duplicated-type |
---|---|---|---|---|---|---|
Sed04g2542 | Sed-Chr4:38225151 | Sed04g2545 | Sed-Chr4:38225151 | 1.10E-109 | dispersed | |
Sed04g2541 | Sed-Chr4:38225151 | Sed04g2542 | Sed-Chr4:38225151 | 1.70E-108 | tandem | |
Sed04g2542 | Sed-Chr4:38225151 | Sed04g2543 | Sed-Chr4:38225151 | 1.50E-108 | tandem |
Pathway information

Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
---|---|---|---|---|---|---|
Sed04g2542 | K02137 | - | rcu:8272168 | 315.464 |