Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Sed04g2543 ATGTTCAAATTGGTTGATGCCTGGCCGCTCTCAAGGACTTATGCCGCTACATCAGAGAAAAATGAAAAAAAGGTGAAGGTGCCACTTGCTTTGTTTGGAGGGTCTGGTAACTATGCCTCTGCTCTGTATATAGCTGCAGTAAAAGCTAATTCTCTTGGCAAGGTGGAGTCTGAGCTTGTTAACCTTGTCGATGCTATTAAGAAAAGTCCTACATTTGCTCAGTTCACAATGGACCTGTCAGTTCCAGCAGAAACTAGAGTTAAGGCTATCAATGAAATTTCTGCTGAAGCTAAATTTTCGGACGTTGTAAAGAACTTCTTGGTTGTTTTGGCTGAGAACGGGAGGCTGAGATATGCAGATAGCATAGCAAAGAGATTTTTGGAGTTGACTATGGCTCATAAGGGAGAACTTAAAGCAGTTGTTACTACTGTTATTCCCATTCCCCCACAAGAAGAGAAAGAATTGAAGGAGACATTGCAAGATATATTTGGACAAGGCAAGAAGGTTAAGCTCGAGCAGAAGATTGATCCCAGCATACTTGGTGGTCTAGTTGTAGAATTTGGCGAGAAAGTATTTGACATGTCTATCAAAACCCGTGCCCGTCAAATGGAGAGGTTCTTGCGCCAACCTGTTACTCTTGACTAG 645 42.33 MFKLVDAWPLSRTYAATSEKNEKKVKVPLALFGGSGNYASALYIAAVKANSLGKVESELVNLVDAIKKSPTFAQFTMDLSVPAETRVKAINEISAEAKFSDVVKNFLVVLAENGRLRYADSIAKRFLELTMAHKGELKAVVTTVIPIPPQEEKELKETLQDIFGQGKKVKLEQKIDPSILGGLVVEFGEKVFDMSIKTRARQMERFLRQPVTLD 214
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
4 38225151 38229156 - Sed0003633.3 Sed04g2543 711146
       

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Sed04g2543 214 ProSitePatterns ATP synthase delta (OSCP) subunit signature. 169 188 IPR020781 GO:0015986(InterPro)|GO:0016020(InterPro)|GO:0046933(InterPro)
Sed04g2543 214 Pfam ATP synthase delta (OSCP) subunit 36 205 IPR000711 GO:0015986(InterPro)|GO:0046933(InterPro)
Sed04g2543 214 Hamap ATP synthase subunit delta [atpD]. 30 209 IPR000711 GO:0015986(InterPro)|GO:0046933(InterPro)
Sed04g2543 214 PANTHER ATP SYNTHASE DELTA CHAIN 15 210 IPR000711 GO:0000274(PANTHER)|GO:0015986(InterPro)|GO:0015986(PANTHER)|GO:0042776(PANTHER)|GO:0045261(PANTHER)|GO:0046933(InterPro)|GO:0046933(PANTHER)
Sed04g2543 214 Gene3D - 34 127 IPR026015 -
Sed04g2543 214 PRINTS ATP synthase delta subunit signature 34 53 IPR000711 GO:0015986(InterPro)|GO:0046933(InterPro)
Sed04g2543 214 PRINTS ATP synthase delta subunit signature 182 200 IPR000711 GO:0015986(InterPro)|GO:0046933(InterPro)
Sed04g2543 214 PRINTS ATP synthase delta subunit signature 115 129 IPR000711 GO:0015986(InterPro)|GO:0046933(InterPro)
Sed04g2543 214 PRINTS ATP synthase delta subunit signature 167 182 IPR000711 GO:0015986(InterPro)|GO:0046933(InterPro)
Sed04g2543 214 PRINTS ATP synthase delta subunit signature 104 115 IPR000711 GO:0015986(InterPro)|GO:0046933(InterPro)
Sed04g2543 214 NCBIfam ATP synthase F1 subunit delta 37 206 IPR000711 GO:0015986(InterPro)|GO:0046933(InterPro)
Sed04g2543 214 SUPERFAMILY N-terminal domain of the delta subunit of the F1F0-ATP synthase 35 136 IPR026015 -
       

Duplication type information

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Sed04g2543 Sed-Chr4:38225151 Sed04g2545 Sed-Chr4:38225151 1.60E-108 dispersed
Sed04g2542 Sed-Chr4:38225151 Sed04g2543 Sed-Chr4:38225151 1.50E-108 tandem
Sed04g2543 Sed-Chr4:38225151 Sed04g2544 Sed-Chr4:38225151 1.60E-108 tandem
       

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Sed04g2543 K02137 - rcu:8272168 315.079