Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Sed05g2146 ATGAGAGAGGTTGAAGGGAGAAGGGTTTGCCAGGAGTTTTCAGCAGGGTATTATGGTCTTTGTGCTGTTGGAGGAATGCTCAGTGCTGGAACAACCCATCTTGCTATTACACCTCTGGATGTCTTGAAGGTTAATATGCAGGTTAATCCAATCAAGTACAATGGCATTTCTTCTGGTTTTTCCATTCTTTGGAGGGAACAAGGTCCTTCATCCCTTTGGAGAGGTTGGTCAGGCAAGTTATTTGGCTACGGTGTTCAAGGCGGTTTCAAATTCGGTCTCTACGAGTACTTTAAGAAGTTTTACTCTGATTTGCTGGAAGGCCATGGCAGAAGCTCCATATACTTTCTCAGCAGTGCTTCTGCTCAAGTTTTTGCTGATGTTGCTCTCTGTCCTTTTGAAGCTGTCAAGGTCAGAGTTCAGACACAACCCTATTATGCCAAGGGATTGGCTGATGGGTTTCCAAAGTTATACTACAGTGAAGGTCTTTCAGGTTTCTACAGAGGGCTTTTTCCACTTTGGGGGCGAAATCTTCCATTCTCCATGATTATGTTCTCAACATTTGAGCATTCAGTAGACTTCATATATCAAAATATCATTCAACGCAGAAAGGAAGATTGCTCAAGAATCCAACAGCTCGGCGTTACATGTTTAGCTGGCTATGCAGCTGGAGCTGTCGGTACTGTTGTCTCAAATCCGGCTGATAATATTGTTTCCTCTCTTTATAATAAAAAAGCTGATACTATAGTGCAGGCAGTGAAGAACATTGGATTTGGCAATTTATTTACTAGAAGCCTTCCTGTCAGAATTGCACTTGTTGGTCCTGCTGTTACTTTGCAATGGTTCTTCTATGACACCATTAAAGTTCTAAGTGGACTGCCTACAAGTGGAGGACTGAACAGGTTGTTGGAAGAGGCAAAACTACCAACTTAG 930 42.58 MREVEGRRVCQEFSAGYYGLCAVGGMLSAGTTHLAITPLDVLKVNMQVNPIKYNGISSGFSILWREQGPSSLWRGWSGKLFGYGVQGGFKFGLYEYFKKFYSDLLEGHGRSSIYFLSSASAQVFADVALCPFEAVKVRVQTQPYYAKGLADGFPKLYYSEGLSGFYRGLFPLWGRNLPFSMIMFSTFEHSVDFIYQNIIQRRKEDCSRIQQLGVTCLAGYAAGAVGTVVSNPADNIVSSLYNKKADTIVQAVKNIGFGNLFTRSLPVRIALVGPAVTLQWFFYDTIKVLSGLPTSGGLNRLLEEAKLPT 309
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
5 34471776 34477210 - Sed0025935.1 Sed05g2146 714772

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Sed05g2146 309 Pfam Mitochondrial carrier protein 21 102 IPR018108 -
Sed05g2146 309 Pfam Mitochondrial carrier protein 113 195 IPR018108 -
Sed05g2146 309 ProSiteProfiles Solute carrier (Solcar) repeat profile. 16 100 IPR018108 -
Sed05g2146 309 SUPERFAMILY Mitochondrial carrier 20 285 IPR023395 -
Sed05g2146 309 ProSiteProfiles Solute carrier (Solcar) repeat profile. 210 289 IPR018108 -
Sed05g2146 309 FunFam Mitochondrial phosphate carrier protein 1, mitochondrial 19 290 - -
Sed05g2146 309 PANTHER SOLUTE CARRIER FAMILY 25 (MITOCHONDRIAL CARRIER PHOSPHATE CARRIER), MEMBER 3, LIKE-RELATED-RELATED 8 298 IPR044677 GO:0005315(PANTHER)|GO:0005315(InterPro)|GO:0031305(PANTHER)|GO:0035435(PANTHER)|GO:1990547(InterPro)
Sed05g2146 309 Gene3D Mitochondrial carrier domain 21 289 IPR023395 -
Sed05g2146 309 ProSiteProfiles Solute carrier (Solcar) repeat profile. 109 193 IPR018108 -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Sed05g2146 K15102 - - csv:101219895 578.556
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Sed05g2146 Sed-Chr5:34471776 Sed08g1540 Sed-Chr8:30270133 3.50E-88 dispersed
Sed05g2146 Sed-Chr5:34471776 Sed05g2147 Sed-Chr5:34471776 1.50E-179 tandem
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Sed13g1378 . 1 441 Chloroplast and Mitochondria Gene Families AT2G28800 61.8 1.2e-134 477.6
Sed04g0012 . 71 408 Chloroplast and Mitochondria Gene Families AT2G28800 56.1 6.8e-98 355.5
Sed04g0013 . 1 295 Chloroplast and Mitochondria Gene Families AT2G28800 57.3 1.4e-87 321.2
Sed10g1833 . 3 256 Chloroplast and Mitochondria Gene Families AT1G15820 79.2 8.7e-117 417.5
Sed10g1832 . 3 256 Chloroplast and Mitochondria Gene Families AT1G15820 79.2 1.9e-116 416.4
Sed05g2091 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 89.1 6.2e-143 504.6
Sed04g3726 . 1 264 Chloroplast and Mitochondria Gene Families AT3G27690 87.2 4.9e-140 495.0
Sed10g0156 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 76.5 4.3e-120 428.7
Sed10g0157 . 2 266 Chloroplast and Mitochondria Gene Families AT3G27690 76.8 7.4e-120 427.9
Sed10g0155 . 2 266 Chloroplast and Mitochondria Gene Families AT3G27690 76.8 9.7e-120 427.6
Sed14g1562 . 2 268 Chloroplast and Mitochondria Gene Families AT3G27690 76.1 1.6e-119 426.8
Sed14g1563 . 2 268 Chloroplast and Mitochondria Gene Families AT3G27690 76.1 1.6e-119 426.8
Sed01g2226 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 1.4e-118 423.7
Sed05g1289 . 179 446 Chloroplast and Mitochondria Gene Families AT3G27690 74.5 2.6e-117 419.5
Sed01g0736 . 2 262 Chloroplast and Mitochondria Gene Families AT3G27690 76.4 5.0e-116 415.2
Sed06g1212 . 28 247 Chloroplast and Mitochondria Gene Families AT3G27690 86.8 2.5e-115 412.9
Sed05g1288 . 19 244 Chloroplast and Mitochondria Gene Families AT3G27690 77.3 9.4e-107 384.4
Sed13g1162 . 5 264 Chloroplast and Mitochondria Gene Families AT3G27690 67.0 4.0e-97 352.4
Sed10g1659 . 110 313 Chloroplast and Mitochondria Gene Families AT3G27690 53.1 1.0e-52 204.9
Sed06g0152 . 3 267 Chloroplast and Mitochondria Gene Families AT3G61470 80.5 4.9e-128 454.9
Sed06g1754 . 3 267 Chloroplast and Mitochondria Gene Families AT3G61470 80.1 8.3e-128 454.1
Sed12g1695 . 69 274 Chloroplast and Mitochondria Gene Families AT3G61470 64.1 4.8e-83 305.4
Sed08g2078 . 22 245 Chloroplast and Mitochondria Gene Families AT3G61470 50.6 2.3e-61 233.4
Sed11g0951 . 43 253 Chloroplast and Mitochondria Gene Families AT3G61470 50.5 1.6e-54 210.7
Sed01g2838 . 1 200 Chloroplast and Mitochondria Gene Families AT3G54890 79.5 2.0e-87 319.7
Sed14g0644 . 6 288 Chloroplast and Mitochondria Gene Families AT3G08940 79.2 1.9e-128 456.4
Sed14g0643 . 6 307 Chloroplast and Mitochondria Gene Families AT3G08940 73.8 2.8e-124 442.6
Sed01g2387 . 1 330 Chloroplast and Mitochondria Gene Families AT1G76570 72.8 1.9e-140 496.5
Sed08g1153 . 1 269 Chloroplast and Mitochondria Gene Families AT1G61520 84.6 7.0e-133 471.1
Sed08g1156 . 1 269 Chloroplast and Mitochondria Gene Families AT1G61520 84.6 7.0e-133 471.1
Sed05g2091 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.4 8.5e-144 507.3
Sed04g3726 . 1 264 Chloroplast and Mitochondria Gene Families AT2G05070 87.9 4.4e-140 495.0
Sed10g0156 . 5 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.4 8.6e-120 427.6
Sed01g2226 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 8.6e-120 427.6
Sed10g0157 . 5 266 Chloroplast and Mitochondria Gene Families AT2G05070 78.7 1.5e-119 426.8
Sed10g0155 . 5 266 Chloroplast and Mitochondria Gene Families AT2G05070 78.7 1.9e-119 426.4
Sed14g1562 . 5 268 Chloroplast and Mitochondria Gene Families AT2G05070 77.3 5.6e-119 424.9
Sed14g1563 . 5 268 Chloroplast and Mitochondria Gene Families AT2G05070 77.3 5.6e-119 424.9
Sed05g1289 . 189 446 Chloroplast and Mitochondria Gene Families AT2G05070 79.2 4.7e-118 421.8
Sed06g1212 . 28 247 Chloroplast and Mitochondria Gene Families AT2G05070 87.7 9.8e-116 414.1
Sed01g0736 . 7 262 Chloroplast and Mitochondria Gene Families AT2G05070 77.5 8.3e-115 411.0
Sed05g1288 . 22 244 Chloroplast and Mitochondria Gene Families AT2G05070 79.1 3.7e-107 385.6
Sed13g1162 . 8 264 Chloroplast and Mitochondria Gene Families AT2G05070 67.7 3.5e-97 352.4
Sed10g1659 . 110 313 Chloroplast and Mitochondria Gene Families AT2G05070 53.6 6.9e-53 205.3
Sed05g2091 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.5 4.8e-125 445.3
Sed04g3726 . 1 236 Chloroplast and Mitochondria Gene Families AT2G05100 87.8 2.4e-121 433.0
Sed14g1562 . 5 240 Chloroplast and Mitochondria Gene Families AT2G05100 76.7 6.3e-101 365.2
Sed14g1563 . 5 240 Chloroplast and Mitochondria Gene Families AT2G05100 76.7 6.3e-101 365.2
Sed10g0156 . 5 239 Chloroplast and Mitochondria Gene Families AT2G05100 75.8 8.2e-101 364.8
Sed01g2226 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.0 8.2e-101 364.8
Sed10g0157 . 5 238 Chloroplast and Mitochondria Gene Families AT2G05100 76.2 1.4e-100 364.0
Sed10g0155 . 5 238 Chloroplast and Mitochondria Gene Families AT2G05100 76.2 1.8e-100 363.6
Sed01g0736 . 7 238 Chloroplast and Mitochondria Gene Families AT2G05100 76.5 2.0e-99 360.1
Sed05g1289 . 208 418 Chloroplast and Mitochondria Gene Families AT2G05100 82.0 2.6e-99 359.8
Sed06g1212 . 28 219 Chloroplast and Mitochondria Gene Families AT2G05100 86.5 3.2e-97 352.8
Sed05g1288 . 18 216 Chloroplast and Mitochondria Gene Families AT2G05100 75.4 9.4e-89 324.7
Sed13g1162 . 8 236 Chloroplast and Mitochondria Gene Families AT2G05100 67.6 2.9e-82 303.1
Sed10g1659 . 110 297 Chloroplast and Mitochondria Gene Families AT2G05100 52.3 2.4e-44 177.2
Sed14g0644 . 1 171 Chloroplast and Mitochondria Gene Families AT2G40100 68.2 2.0e-62 236.5
Sed14g0643 . 1 190 Chloroplast and Mitochondria Gene Families AT2G40100 61.5 7.7e-59 224.6
Sed14g1562 . 1 268 Chloroplast and Mitochondria Gene Families AT1G29930 88.1 2.5e-135 479.2
Sed14g1563 . 1 268 Chloroplast and Mitochondria Gene Families AT1G29930 88.1 2.5e-135 479.2
Sed10g0157 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 87.6 3.3e-135 478.8
Sed10g0155 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 87.3 4.3e-135 478.4
Sed01g2226 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 87.6 4.7e-134 474.9
Sed10g0156 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 87.3 8.1e-134 474.2
Sed01g0736 . 1 262 Chloroplast and Mitochondria Gene Families AT1G29930 88.6 3.4e-132 468.8
Sed05g1289 . 182 446 Chloroplast and Mitochondria Gene Families AT1G29930 83.3 6.2e-126 448.0
Sed06g1212 . 4 247 Chloroplast and Mitochondria Gene Families AT1G29930 82.4 3.9e-120 428.7
Sed04g3726 . 3 264 Chloroplast and Mitochondria Gene Families AT1G29930 78.9 7.6e-116 414.5
Sed05g2091 . 30 265 Chloroplast and Mitochondria Gene Families AT1G29930 82.9 4.9e-115 411.8
Sed05g1288 . 21 244 Chloroplast and Mitochondria Gene Families AT1G29930 84.0 4.2e-114 408.7
Sed13g1162 . 22 264 Chloroplast and Mitochondria Gene Families AT1G29930 69.7 1.1e-93 340.9
Sed14g1562 . 1 268 Chloroplast and Mitochondria Gene Families AT1G29920 87.7 9.5e-135 477.2
Sed14g1563 . 1 268 Chloroplast and Mitochondria Gene Families AT1G29920 87.7 9.5e-135 477.2
Sed10g0157 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 87.3 1.2e-134 476.9
Sed10g0155 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 86.9 1.6e-134 476.5
Sed01g2226 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.3 1.8e-133 473.0
Sed10g0156 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 86.9 3.1e-133 472.2
Sed01g0736 . 1 262 Chloroplast and Mitochondria Gene Families AT1G29920 88.3 1.3e-131 466.8
Sed05g1289 . 182 446 Chloroplast and Mitochondria Gene Families AT1G29920 83.3 8.1e-126 447.6
Sed06g1212 . 4 247 Chloroplast and Mitochondria Gene Families AT1G29920 82.4 5.1e-120 428.3
Sed04g3726 . 32 264 Chloroplast and Mitochondria Gene Families AT1G29920 84.8 9.9e-116 414.1
Sed05g2091 . 30 265 Chloroplast and Mitochondria Gene Families AT1G29920 82.9 4.9e-115 411.8
Sed05g1288 . 21 244 Chloroplast and Mitochondria Gene Families AT1G29920 84.0 4.2e-114 408.7
Sed13g1162 . 22 264 Chloroplast and Mitochondria Gene Families AT1G29920 69.7 1.1e-93 340.9
Sed14g1562 . 1 268 Chloroplast and Mitochondria Gene Families AT1G29910 87.7 9.5e-135 477.2
Sed14g1563 . 1 268 Chloroplast and Mitochondria Gene Families AT1G29910 87.7 9.5e-135 477.2
Sed10g0157 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 87.3 1.2e-134 476.9
Sed10g0155 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 86.9 1.6e-134 476.5
Sed01g2226 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.3 1.8e-133 473.0
Sed10g0156 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 86.9 3.1e-133 472.2
Sed01g0736 . 1 262 Chloroplast and Mitochondria Gene Families AT1G29910 88.3 1.3e-131 466.8
Sed05g1289 . 182 446 Chloroplast and Mitochondria Gene Families AT1G29910 83.3 8.1e-126 447.6
Sed06g1212 . 4 247 Chloroplast and Mitochondria Gene Families AT1G29910 82.4 5.1e-120 428.3
Sed04g3726 . 32 264 Chloroplast and Mitochondria Gene Families AT1G29910 84.8 9.9e-116 414.1
Sed05g2091 . 30 265 Chloroplast and Mitochondria Gene Families AT1G29910 82.9 4.9e-115 411.8
Sed05g1288 . 21 244 Chloroplast and Mitochondria Gene Families AT1G29910 84.0 4.2e-114 408.7
Sed13g1162 . 22 264 Chloroplast and Mitochondria Gene Families AT1G29910 69.7 1.1e-93 340.9
Sed10g1659 . 50 328 Chloroplast and Mitochondria Gene Families AT4G10340 84.6 1.7e-134 476.5
Sed14g1562 . 41 256 Chloroplast and Mitochondria Gene Families AT4G10340 51.5 3.8e-57 219.5
Sed14g1563 . 41 256 Chloroplast and Mitochondria Gene Families AT4G10340 51.5 3.8e-57 219.5
Sed10g0155 . 50 254 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 4.9e-57 219.2
Sed10g0156 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 4.9e-57 219.2
Sed10g0157 . 50 254 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 4.9e-57 219.2
Sed01g0736 . 50 254 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 4.9e-57 219.2
Sed01g2226 . 40 253 Chloroplast and Mitochondria Gene Families AT4G10340 53.2 1.9e-56 217.2
Sed05g1289 . 230 434 Chloroplast and Mitochondria Gene Families AT4G10340 53.1 3.2e-56 216.5
Sed06g1212 . 31 235 Chloroplast and Mitochondria Gene Families AT4G10340 53.1 4.2e-56 216.1
Sed05g2091 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 1.3e-54 211.1
Sed04g3726 . 48 252 Chloroplast and Mitochondria Gene Families AT4G10340 51.7 5.6e-53 205.7
Sed13g1162 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 53.1 4.0e-51 199.5
Sed14g1562 . 1 268 Chloroplast and Mitochondria Gene Families AT2G34420 87.0 1.5e-132 469.9
Sed14g1563 . 1 268 Chloroplast and Mitochondria Gene Families AT2G34420 87.0 1.5e-132 469.9
Sed10g0157 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34420 86.5 2.0e-132 469.5
Sed10g0155 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34420 86.1 2.6e-132 469.2
Sed01g2226 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 86.5 2.2e-131 466.1
Sed10g0156 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 86.2 4.9e-131 464.9
Sed01g0736 . 1 262 Chloroplast and Mitochondria Gene Families AT2G34420 88.3 3.2e-130 462.2
Sed05g1289 . 188 446 Chloroplast and Mitochondria Gene Families AT2G34420 84.7 3.1e-125 445.7
Sed06g1212 . 29 247 Chloroplast and Mitochondria Gene Families AT2G34420 92.7 3.5e-121 432.2
Sed04g3726 . 32 264 Chloroplast and Mitochondria Gene Families AT2G34420 84.4 2.2e-115 412.9
Sed05g2091 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 77.5 2.2e-115 412.9
Sed05g1288 . 21 244 Chloroplast and Mitochondria Gene Families AT2G34420 84.0 5.4e-114 408.3
Sed13g1162 . 22 264 Chloroplast and Mitochondria Gene Families AT2G34420 70.1 1.1e-93 340.9
Sed10g1659 . 110 313 Chloroplast and Mitochondria Gene Families AT2G34420 52.4 1.8e-53 207.2
Sed01g2226 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.2 1.2e-134 476.9
Sed14g1562 . 1 268 Chloroplast and Mitochondria Gene Families AT2G34430 88.1 6.2e-134 474.6
Sed14g1563 . 1 268 Chloroplast and Mitochondria Gene Families AT2G34430 88.1 6.2e-134 474.6
Sed10g0157 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 8.0e-134 474.2
Sed10g0155 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34430 87.3 1.1e-133 473.8
Sed10g0156 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 86.9 2.3e-133 472.6
Sed01g0736 . 1 262 Chloroplast and Mitochondria Gene Families AT2G34430 87.9 5.4e-130 461.5
Sed05g1289 . 182 446 Chloroplast and Mitochondria Gene Families AT2G34430 83.3 5.6e-127 451.4
Sed06g1212 . 29 247 Chloroplast and Mitochondria Gene Families AT2G34430 92.7 4.6e-121 431.8
Sed05g1288 . 22 244 Chloroplast and Mitochondria Gene Families AT2G34430 84.3 2.9e-115 412.5
Sed04g3726 . 32 264 Chloroplast and Mitochondria Gene Families AT2G34430 84.3 1.9e-114 409.8
Sed05g2091 . 31 265 Chloroplast and Mitochondria Gene Families AT2G34430 82.8 2.1e-113 406.4
Sed13g1162 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34430 70.5 1.1e-93 340.9
Sed14g0644 . 3 288 Chloroplast and Mitochondria Gene Families AT5G01530 81.1 5.7e-133 471.5
Sed14g0643 . 3 307 Chloroplast and Mitochondria Gene Families AT5G01530 76.1 1.0e-129 460.7
Sed07g1803 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 94.2 4.9e-144 508.1
Sed13g1065 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.8 1.4e-143 506.5
Sed13g1067 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.8 1.4e-143 506.5
Sed13g1066 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.8 1.4e-143 506.5
Sed07g1803 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 85.8 2.1e-149 526.2
Sed13g1065 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 84.2 6.6e-148 521.2
Sed13g1067 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 84.2 6.6e-148 521.2
Sed13g1066 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 84.2 6.6e-148 521.2
Sed05g3793 . 5 323 Chloroplast and Mitochondria Gene Families AT2G30160 74.4 1.5e-137 486.9
Sed03g2513 . 81 360 Chloroplast and Mitochondria Gene Families AT2G30160 63.3 2.2e-101 366.7
Sed05g3793 . 5 329 Chloroplast and Mitochondria Gene Families AT1G07030 75.0 2.4e-140 496.1
Sed03g2513 . 60 360 Chloroplast and Mitochondria Gene Families AT1G07030 61.0 1.9e-105 380.2
Sed07g0557 . 1 301 Chloroplast and Mitochondria Gene Families AT2G47490 76.4 1.5e-131 466.8
Sed03g1162 . 11 313 Chloroplast and Mitochondria Gene Families AT2G47490 61.4 1.1e-105 380.9
Sed07g0813 . 1 297 Chloroplast and Mitochondria Gene Families AT2G47490 62.8 6.0e-96 348.6
Sed03g1162 . 10 362 Chloroplast and Mitochondria Gene Families AT1G25380 63.8 1.3e-121 434.1
Sed07g0557 . 12 293 Chloroplast and Mitochondria Gene Families AT1G25380 65.3 4.3e-106 382.5
Sed07g0813 . 12 289 Chloroplast and Mitochondria Gene Families AT1G25380 53.5 7.5e-74 275.4
Sed01g2055 . 7 584 Chloroplast and Mitochondria Gene Families AT4G21490 75.0 3.3e-257 885.2
Sed01g2056 . 7 584 Chloroplast and Mitochondria Gene Families AT4G21490 75.0 3.3e-257 885.2
Sed08g2309 . 7 573 Chloroplast and Mitochondria Gene Families AT4G21490 73.0 4.3e-249 858.2
Sed05g3116 . 5 584 Chloroplast and Mitochondria Gene Families AT4G21490 69.6 4.0e-239 825.1
Sed05g1975 . 4 574 Chloroplast and Mitochondria Gene Families AT4G21490 65.2 1.8e-226 783.1
Sed09g1672 . 3 182 Chloroplast and Mitochondria Gene Families AT1G17530 65.6 7.4e-62 234.6
Sed04g0795 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 63.8 2.6e-59 226.1
Sed06g0682 . 1 179 Chloroplast and Mitochondria Gene Families AT1G17530 56.9 1.3e-50 197.2
Sed06g0682 . 1 183 Chloroplast and Mitochondria Gene Families AT3G04800 56.5 4.6e-51 198.7
Sed04g0795 . 22 186 Chloroplast and Mitochondria Gene Families AT3G04800 56.3 2.5e-41 166.4
Sed09g1672 . 18 184 Chloroplast and Mitochondria Gene Families AT3G04800 54.4 7.4e-41 164.9
Sed09g1672 . 2 184 Chloroplast and Mitochondria Gene Families AT1G72750 66.8 7.6e-62 234.6
Sed04g0795 . 15 186 Chloroplast and Mitochondria Gene Families AT1G72750 67.2 2.1e-59 226.5
Sed06g0682 . 3 183 Chloroplast and Mitochondria Gene Families AT1G72750 57.1 1.2e-51 200.7
Sed06g1856 . 4 217 Chloroplast and Mitochondria Gene Families AT1G26100 58.9 4.4e-67 252.3
Sed06g1857 . 7 182 Chloroplast and Mitochondria Gene Families AT1G26100 65.3 1.9e-65 246.9
Sed03g0307 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 69.2 8.9e-89 324.3
Sed11g2091 . 1 224 Chloroplast and Mitochondria Gene Families AT5G38630 68.0 4.6e-85 312.0
Sed01g3590 . 23 218 Chloroplast and Mitochondria Gene Families AT4G25570 69.9 9.2e-80 294.7
Sed03g0981 . 6 356 Chloroplast and Mitochondria Gene Families AT5G14040 81.6 2.0e-170 596.3
Sed11g1566 . 7 356 Chloroplast and Mitochondria Gene Families AT5G14040 82.4 1.7e-169 593.2
Sed08g1540 . 5 354 Chloroplast and Mitochondria Gene Families AT5G14040 73.3 3.3e-149 525.8
Sed05g2146 . 11 298 Chloroplast and Mitochondria Gene Families AT5G14040 52.4 2.0e-85 313.9
Sed05g2147 . 11 298 Chloroplast and Mitochondria Gene Families AT5G14040 52.4 2.0e-85 313.9
Sed03g0982 . 15 283 Chloroplast and Mitochondria Gene Families AT5G14040 52.6 8.0e-71 265.4
Sed11g1566 . 8 356 Chloroplast and Mitochondria Gene Families AT3G48850 71.2 5.2e-144 508.4
Sed03g0981 . 8 356 Chloroplast and Mitochondria Gene Families AT3G48850 69.2 2.4e-141 499.6
Sed08g1540 . 8 361 Chloroplast and Mitochondria Gene Families AT3G48850 69.7 3.2e-141 499.2
Sed05g2146 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 51.5 1.1e-85 314.7
Sed05g2147 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 51.5 1.1e-85 314.7
Sed05g2146 . 14 307 Chloroplast and Mitochondria Gene Families AT2G17270 75.5 6.7e-132 468.0
Sed05g2147 . 14 307 Chloroplast and Mitochondria Gene Families AT2G17270 75.5 6.7e-132 468.0
Sed08g1540 . 57 352 Chloroplast and Mitochondria Gene Families AT2G17270 52.4 8.6e-87 318.2
Sed11g1566 . 62 353 Chloroplast and Mitochondria Gene Families AT2G17270 52.4 2.8e-85 313.2
Sed03g0981 . 56 347 Chloroplast and Mitochondria Gene Families AT2G17270 52.1 3.6e-85 312.8
Sed11g2055 . 16 319 Chloroplast and Mitochondria Gene Families AT5G15640 75.6 4.4e-131 465.3
Sed13g1891 . 12 346 Chloroplast and Mitochondria Gene Families AT5G26200 67.5 3.3e-124 442.6
Sed09g1667 . 1 347 Chloroplast and Mitochondria Gene Families AT5G26200 59.0 5.7e-108 388.7
Sed09g1667 . 1 352 Chloroplast and Mitochondria Gene Families AT1G72820 74.4 7.0e-146 514.6
Sed13g1891 . 1 347 Chloroplast and Mitochondria Gene Families AT1G72820 68.4 2.8e-126 449.5
Sed01g3857 . 79 284 Chloroplast and Mitochondria Gene Families AT5G52570 51.0 8.3e-50 194.9
Sed13g0115 . 1 217 Chloroplast and Mitochondria Gene Families AT4G25700 64.8 3.7e-71 265.8
Sed07g0989 . 1 225 Chloroplast and Mitochondria Gene Families AT4G25700 60.9 1.0e-65 247.7
Sed07g0991 . 1 225 Chloroplast and Mitochondria Gene Families AT4G25700 60.9 1.0e-65 247.7
Sed07g0988 . 1 221 Chloroplast and Mitochondria Gene Families AT4G25700 61.1 8.7e-65 244.6
Sed07g0990 . 1 221 Chloroplast and Mitochondria Gene Families AT4G25700 61.1 8.7e-65 244.6
Sed01g3857 . 40 200 Chloroplast and Mitochondria Gene Families AT4G25700 60.9 6.9e-54 208.4
Sed07g1878 . 96 358 Chloroplast and Mitochondria Gene Families AT5G54290 85.2 2.0e-119 426.8
Sed08g0534 . 65 552 Chloroplast and Mitochondria Gene Families AT2G18710 85.2 1.8e-236 816.2
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0012022 0 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 2 30