Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Sed06g0903 ATGCCATCGGCTCAAGATCCATTCTATGTTGTAAAAGACGAGATTCAAGAATCTATCGATAAGCTGCAATTCAGCTTTCACCAATGGGAAAGGATATCTTCCAATCCAGGAGAGAGAGTACAACTTAAGAAAGAGGTGCTTGCTGCCTGTGAGAGCATTGAATGGCAGGTGGATGAATTAGATAAAGCTATTTCTGTGGCGGCTAGAGATCCTTCGTTGTATGGCATTGATGATGCAGAACTTGAAAAACGAAGGAGATGGACGAGTACGGCTAGAACACAGGTTGGAAATGTTAAGAGAGTAGTGGGAGCTGGAAAAGAGCAAACTGGACCTGCTAGTGCAAATGGGATGCGTCGAGAATTGATGCGACTACCTGATGCACATGAAACAGACAGATCAAATGTATATACAGCACACCAATCAAATGATGACTTCATCTCGTCGGAATCAGATAGACAGTTGCTTCTCATAAGGCAGCAGGACGAGGAGTTGGATGAGCTGAGCGCAAGCGTGCAGAGAATTGGAGGCGTTGGGCTTACAATACACGAAGAGCTCCTTGCACAGGATAAAATCATGGAGGATCTAGGAATGGAAATGGACAGTACATCGAATCGTCTTGATTTTGTTCAGAAAAAAGTAGGCATGGTAATGAAGAAAGCGAGCGCCAAGGGGCAGTTGGTGATGATACTGTTCTTGGTGGCTTTGTTCATCATCCTTTTTGTATTGGTGTTCCTCACCTAG 741 44.4 MPSAQDPFYVVKDEIQESIDKLQFSFHQWERISSNPGERVQLKKEVLAACESIEWQVDELDKAISVAARDPSLYGIDDAELEKRRRWTSTARTQVGNVKRVVGAGKEQTGPASANGMRRELMRLPDAHETDRSNVYTAHQSNDDFISSESDRQLLLIRQQDEELDELSASVQRIGGVGLTIHEELLAQDKIMEDLGMEMDSTSNRLDFVQKKVGMVMKKASAKGQLVMILFLVALFIILFVLVFLT 246
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
6 11026636 11039597 - Sed0001901.2 Sed06g0903 717446

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Sed06g0903 246 PANTHER SYNTAXIN 11 230 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0006886(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Sed06g0903 246 CDD SNARE_NTD_AtSYP61-like 5 102 - -
Sed06g0903 246 FunFam Syntaxin 10 3 105 - -
Sed06g0903 246 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 154 216 IPR000727 -
Sed06g0903 246 FunFam syntaxin-61 isoform X1 157 218 - -
Sed06g0903 246 SUPERFAMILY SNARE fusion complex 153 216 - -
Sed06g0903 246 Pfam SNARE domain 191 242 IPR000727 -
Sed06g0903 246 SMART tSNARE_6 149 216 IPR000727 -
Sed06g0903 246 Gene3D - 2 104 - -
Sed06g0903 246 SUPERFAMILY t-snare proteins 5 100 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Sed06g0903 246 Pfam Syntaxin 6, N-terminal 6 99 IPR015260 GO:0016020(InterPro)|GO:0048193(InterPro)
Sed06g0903 246 CDD SNARE_Qc 157 213 - -
Sed06g0903 246 Gene3D - 161 225 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Sed06g0903 K08500 - - csv:101212527 398.282
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Sed06g0903 Sed-Chr6:11026636 Sed10g1783 Sed-Chr10:34904962 1.60E-115 dispersed
Sed06g0902 Sed-Chr6:11026636 Sed06g0903 Sed-Chr6:11026636 1.00E-130 tandem
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi11g1007 . . . . Bpe01g00692 . . Bma11g00689 . Cmo11g00391 . . Car05g00628 . Sed12g2220 Cpe04g01302 . Bhi02g00761 Tan09g1680 Cmetu02g0455 . Hepe09g0484 . . Cla11g01187 Cam11g1246 Cec11g1260 Cco11g1257 Clacu11g1406 Cmu11g1230 Cre11g1650 . . Cone11ag0181 Cone18ag1304 Lsi06g01172 Csa02g00629 Chy05g00905 Cme02g01561 . Blo14g00662 Bda02g00280 . . . . . Sed06g0903 . . . Cma11g00395 . Car11g00364 Cpe11g00643 . Bhi06g01262 Tan08g0837 Cmetu05g0796 . Hepe08g2132 . . Cla06g01327 Cam06g1477 Cec06g1533 Cco06g1529 Clacu06g1435 Cmu06g1397 Cre06g2205 Lsi11g00755 Csa01g02149 Chy02g02224 .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Sed03g1567 . 8 339 SNARE and Associated Proteins AT3G24350 64.2 2.6e-103 373.2
Sed01g1323 . 8 334 SNARE and Associated Proteins AT3G24350 64.5 1.4e-101 367.5
Sed01g1324 . 8 334 SNARE and Associated Proteins AT3G24350 64.5 1.4e-101 367.5
Sed01g1325 . 28 354 SNARE and Associated Proteins AT3G24350 64.5 1.4e-101 367.5
Sed01g1326 . 8 334 SNARE and Associated Proteins AT3G24350 64.5 1.4e-101 367.5
Sed03g1566 . 8 287 SNARE and Associated Proteins AT3G24350 61.4 3.1e-80 296.6
Sed03g2400 . 1 308 SNARE and Associated Proteins AT1G08560 69.0 3.3e-102 369.4
Sed14g0695 . 1 308 SNARE and Associated Proteins AT1G08560 69.3 3.6e-101 365.9
Sed10g0918 . 1 291 SNARE and Associated Proteins AT2G18260 52.8 2.5e-78 290.0
Sed12g1336 . 19 279 SNARE and Associated Proteins AT3G11820 80.5 1.5e-115 413.7
Sed01g2057 . 31 282 SNARE and Associated Proteins AT3G11820 66.7 2.4e-92 336.7
Sed08g2301 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 1.5e-91 334.0
Sed14g0266 . 28 276 SNARE and Associated Proteins AT3G11820 68.3 2.9e-90 329.7
Sed14g0267 . 28 276 SNARE and Associated Proteins AT3G11820 68.3 2.9e-90 329.7
Sed12g1058 . 24 284 SNARE and Associated Proteins AT3G11820 52.9 3.3e-70 263.1
Sed02g0884 . 25 283 SNARE and Associated Proteins AT3G11820 51.4 2.2e-66 250.4
Sed12g1060 . 24 230 SNARE and Associated Proteins AT3G11820 50.7 7.0e-52 202.2
Sed12g1059 . 24 228 SNARE and Associated Proteins AT3G11820 50.7 4.5e-51 199.5
Sed12g1336 . 30 279 SNARE and Associated Proteins AT3G52400 68.8 2.7e-89 326.6
Sed01g2057 . 1 282 SNARE and Associated Proteins AT3G52400 57.2 4.5e-81 299.3
Sed08g2301 . 1 281 SNARE and Associated Proteins AT3G52400 55.0 9.5e-79 291.6
Sed14g0266 . 28 276 SNARE and Associated Proteins AT3G52400 61.0 6.8e-77 285.4
Sed14g0267 . 28 276 SNARE and Associated Proteins AT3G52400 61.0 6.8e-77 285.4
Sed08g2301 . 1 295 SNARE and Associated Proteins AT4G03330 69.5 2.5e-107 386.3
Sed01g2057 . 1 300 SNARE and Associated Proteins AT4G03330 67.3 5.3e-105 378.6
Sed12g1336 . 1 279 SNARE and Associated Proteins AT4G03330 57.5 1.4e-81 300.8
Sed12g1058 . 1 284 SNARE and Associated Proteins AT4G03330 53.1 3.8e-71 266.2
Sed14g0266 . 28 274 SNARE and Associated Proteins AT4G03330 52.2 2.0e-67 253.8
Sed14g0267 . 28 274 SNARE and Associated Proteins AT4G03330 52.2 2.0e-67 253.8
Sed02g0884 . 1 283 SNARE and Associated Proteins AT4G03330 50.2 4.4e-67 252.7
Sed12g1060 . 1 230 SNARE and Associated Proteins AT4G03330 51.7 3.6e-53 206.5
Sed08g2301 . 1 303 SNARE and Associated Proteins AT1G61290 79.2 7.5e-128 454.5
Sed01g2057 . 1 304 SNARE and Associated Proteins AT1G61290 77.6 2.7e-125 446.0
Sed12g1336 . 1 279 SNARE and Associated Proteins AT1G61290 61.9 8.1e-90 328.2
Sed14g0266 . 1 292 SNARE and Associated Proteins AT1G61290 52.5 1.3e-76 284.3
Sed14g0267 . 1 292 SNARE and Associated Proteins AT1G61290 52.5 1.3e-76 284.3
Sed08g2301 . 1 303 SNARE and Associated Proteins AT1G11250 77.9 2.9e-124 442.6
Sed01g2057 . 1 304 SNARE and Associated Proteins AT1G11250 76.3 2.7e-122 436.0
Sed12g1336 . 1 279 SNARE and Associated Proteins AT1G11250 61.6 1.9e-91 333.6
Sed14g0266 . 1 287 SNARE and Associated Proteins AT1G11250 54.7 2.0e-80 297.0
Sed14g0267 . 1 287 SNARE and Associated Proteins AT1G11250 54.7 2.0e-80 297.0
Sed02g0884 . 1 283 SNARE and Associated Proteins AT1G11250 50.5 7.0e-70 261.9
Sed12g1058 . 1 284 SNARE and Associated Proteins AT1G11250 50.7 2.7e-69 260.0
Sed12g1058 . 1 307 SNARE and Associated Proteins AT3G03800 72.6 2.5e-115 412.9
Sed02g0884 . 1 306 SNARE and Associated Proteins AT3G03800 73.7 2.4e-113 406.4
Sed12g1060 . 1 230 SNARE and Associated Proteins AT3G03800 71.3 1.9e-86 317.0
Sed12g1059 . 1 228 SNARE and Associated Proteins AT3G03800 71.5 1.2e-85 314.3
Sed02g0885 . 1 229 SNARE and Associated Proteins AT3G03800 73.2 6.1e-85 312.0
Sed02g0886 . 1 229 SNARE and Associated Proteins AT3G03800 73.2 6.1e-85 312.0
Sed02g0887 . 1 229 SNARE and Associated Proteins AT3G03800 73.2 6.1e-85 312.0
Sed05g3073 . 47 320 SNARE and Associated Proteins AT3G03800 57.3 2.4e-81 300.1
Sed12g1058 . 1 202 SNARE and Associated Proteins AT5G08080 75.2 2.2e-76 283.1
Sed12g1059 . 1 202 SNARE and Associated Proteins AT5G08080 75.2 2.2e-76 283.1
Sed12g1060 . 1 202 SNARE and Associated Proteins AT5G08080 75.2 2.2e-76 283.1
Sed02g0884 . 1 201 SNARE and Associated Proteins AT5G08080 75.4 2.7e-74 276.2
Sed02g0885 . 1 201 SNARE and Associated Proteins AT5G08080 75.4 2.7e-74 276.2
Sed02g0886 . 1 201 SNARE and Associated Proteins AT5G08080 75.4 2.7e-74 276.2
Sed02g0887 . 1 201 SNARE and Associated Proteins AT5G08080 75.4 2.7e-74 276.2
Sed05g3073 . 29 219 SNARE and Associated Proteins AT5G08080 58.6 2.1e-50 196.8
Sed02g0066 . 66 321 SNARE and Associated Proteins AT5G16830 59.5 1.0e-75 281.2
Sed04g0861 . 1 255 SNARE and Associated Proteins AT5G16830 60.3 2.6e-74 276.6
Sed02g0067 . 66 318 SNARE and Associated Proteins AT5G16830 59.5 2.6e-74 276.6
Sed02g0066 . 66 321 SNARE and Associated Proteins AT5G46860 64.5 6.3e-78 288.5
Sed04g0861 . 1 255 SNARE and Associated Proteins AT5G46860 65.6 2.4e-77 286.6
Sed02g0067 . 66 318 SNARE and Associated Proteins AT5G46860 64.4 1.6e-76 283.9
Sed02g0066 . 66 321 SNARE and Associated Proteins AT4G17730 60.2 1.2e-73 274.2
Sed02g0067 . 66 307 SNARE and Associated Proteins AT4G17730 62.3 2.1e-73 273.5
Sed04g0861 . 1 255 SNARE and Associated Proteins AT4G17730 60.5 1.2e-70 264.2
Sed02g0066 . 130 321 SNARE and Associated Proteins AT1G32270 60.9 2.0e-52 204.1
Sed02g0067 . 130 322 SNARE and Associated Proteins AT1G32270 60.1 7.6e-52 202.2
Sed04g0861 . 65 255 SNARE and Associated Proteins AT1G32270 58.1 2.1e-49 194.1
Sed07g2558 . 1 334 SNARE and Associated Proteins AT5G05760 65.7 8.4e-112 401.4
Sed04g2893 . 1 334 SNARE and Associated Proteins AT5G05760 63.8 3.3e-108 389.4
Sed07g2559 . 1 218 SNARE and Associated Proteins AT5G05760 59.0 2.6e-60 230.3
Sed03g1567 . 8 339 SNARE and Associated Proteins AT3G24350 64.2 2.6e-103 373.2
Sed01g1323 . 8 334 SNARE and Associated Proteins AT3G24350 64.5 1.4e-101 367.5
Sed01g1324 . 8 334 SNARE and Associated Proteins AT3G24350 64.5 1.4e-101 367.5
Sed01g1325 . 28 354 SNARE and Associated Proteins AT3G24350 64.5 1.4e-101 367.5
Sed01g1326 . 8 334 SNARE and Associated Proteins AT3G24350 64.5 1.4e-101 367.5
Sed03g1566 . 8 287 SNARE and Associated Proteins AT3G24350 61.4 3.1e-80 296.6
Sed03g1942 . 1 327 SNARE and Associated Proteins AT5G26980 74.6 6.3e-125 444.9
Sed11g0395 . 1 325 SNARE and Associated Proteins AT5G26980 75.4 6.3e-125 444.9
Sed07g0550 . 1 320 SNARE and Associated Proteins AT5G26980 66.5 8.0e-104 374.8
Sed11g0396 . 1 244 SNARE and Associated Proteins AT5G26980 73.8 2.8e-88 323.2
Sed03g1943 . 1 246 SNARE and Associated Proteins AT5G26980 72.8 8.1e-88 321.6
Sed07g0551 . 1 245 SNARE and Associated Proteins AT5G26980 61.6 3.8e-69 259.6
Sed07g0550 . 1 320 SNARE and Associated Proteins AT4G02195 66.1 2.5e-105 379.8
Sed03g1942 . 1 329 SNARE and Associated Proteins AT4G02195 62.8 2.0e-102 370.2
Sed11g0395 . 1 327 SNARE and Associated Proteins AT4G02195 62.6 9.9e-102 367.9
Sed07g0551 . 1 259 SNARE and Associated Proteins AT4G02195 57.8 1.8e-71 267.3
Sed03g1943 . 1 246 SNARE and Associated Proteins AT4G02195 60.1 5.5e-68 255.8
Sed11g0396 . 1 244 SNARE and Associated Proteins AT4G02195 59.3 2.3e-66 250.4
Sed03g1942 . 1 328 SNARE and Associated Proteins AT3G05710 75.4 8.2e-128 454.5
Sed11g0395 . 1 326 SNARE and Associated Proteins AT3G05710 74.8 7.7e-126 448.0
Sed07g0550 . 1 320 SNARE and Associated Proteins AT3G05710 63.7 3.6e-99 359.4
Sed03g1943 . 1 246 SNARE and Associated Proteins AT3G05710 72.1 3.4e-89 326.2
Sed11g0396 . 1 244 SNARE and Associated Proteins AT3G05710 71.3 1.1e-87 321.2
Sed07g0551 . 1 241 SNARE and Associated Proteins AT3G05710 58.7 4.4e-65 246.1
Sed04g3695 . 1 233 SNARE and Associated Proteins AT1G16240 70.8 1.3e-87 320.5
Sed07g2702 . 1 231 SNARE and Associated Proteins AT1G16240 72.1 2.2e-87 319.7
Sed07g2703 . 1 231 SNARE and Associated Proteins AT1G16240 72.1 2.2e-87 319.7
Sed07g2704 . 1 231 SNARE and Associated Proteins AT1G16240 72.1 2.2e-87 319.7
Sed07g2705 . 1 231 SNARE and Associated Proteins AT1G16240 72.1 2.2e-87 319.7
Sed07g2702 . 1 231 SNARE and Associated Proteins AT1G79590 71.2 2.5e-87 319.7
Sed07g2703 . 1 231 SNARE and Associated Proteins AT1G79590 71.2 2.5e-87 319.7
Sed07g2704 . 1 231 SNARE and Associated Proteins AT1G79590 71.2 2.5e-87 319.7
Sed07g2705 . 1 231 SNARE and Associated Proteins AT1G79590 71.2 2.5e-87 319.7
Sed04g3695 . 1 233 SNARE and Associated Proteins AT1G79590 70.4 9.6e-87 317.8
Sed10g1784 . 48 240 SNARE and Associated Proteins AT1G28490 69.9 1.6e-65 246.9
Sed10g1783 . 56 247 SNARE and Associated Proteins AT1G28490 69.3 1.7e-64 243.4
Sed10g1785 . 56 247 SNARE and Associated Proteins AT1G28490 69.3 1.7e-64 243.4
Sed06g0902 . 56 246 SNARE and Associated Proteins AT1G28490 69.6 3.9e-64 242.3
Sed06g0903 . 56 246 SNARE and Associated Proteins AT1G28490 69.6 3.9e-64 242.3
Sed04g1347 . 1 264 SNARE and Associated Proteins AT3G09740 77.4 4.7e-110 395.2
Sed05g2859 . 46 308 SNARE and Associated Proteins AT3G09740 66.8 1.1e-93 340.9
Sed04g1347 . 1 264 SNARE and Associated Proteins AT3G45280 62.9 2.8e-86 316.2
Sed05g2859 . 46 308 SNARE and Associated Proteins AT3G45280 63.8 2.8e-86 316.2
Sed04g1347 . 1 261 SNARE and Associated Proteins AT3G61450 67.0 1.5e-92 337.0
Sed05g2859 . 46 305 SNARE and Associated Proteins AT3G61450 59.0 2.8e-83 306.2
Sed03g0404 . 65 310 SNARE and Associated Proteins AT1G51740 76.6 4.0e-95 345.5
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0003549 2 1 2 2 2 1 2 1 1 1 1 1 2 1 1 2 1 2 1 1 1 1 1 1 1 1 1 5 4 0 44