Gene search
Sequence information

Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
---|---|---|---|---|---|---|
Sed06g0972 | ATGAGGCTTGAACTGGACGACGGCGACGACGACGACGTCGTTCATGTTCCGCCTCACAACTTCTCCACCGTCGACGATGGCATTTTCCGATCCGGTTTCCCTCAGCCTCCCAATTTCCCCTTCCTCGAGAGCCTCAATCTCCGCACCATCATATATCTGTGTCCTGAGCCTTATCCACAGGAGAATTTGGAGTTTCTTAGAGCTAATAACATCAACCTTTTTCAATTCAAAATTGAAGGCACAAAGGAGCCTTTCGATATTCCGAAAGATGCAATCCTCGAGGCCCTGAAAATCCTGATTGATGTTAGGAATCACCCTATTTTGATCCACTGCAAGCGTGGAAAGCATCGAACAGGCTCACTCGTTGGCTGTCTGAGAAAGTTTCAGAACTGGTGCTTGGCTTCGGTGTTCGAGGAGTACAAGCAATTTGCAGGCATGAAATCGAGGACGACGGATCTTCAATTCATTGAGGCATTTGATCTTAAGTCTCTGAGGCAATGCGTTTACAGCATCATATACAAGTACCAAGGTTACAGCTCAAGCAAGAGGAGGCTGCTGTATAGAGAAGAAAAGTTGCAGAAACCCCAAAAAACATCAGTTTAG | 603 | 46.43 | MRLELDDGDDDDVVHVPPHNFSTVDDGIFRSGFPQPPNFPFLESLNLRTIIYLCPEPYPQENLEFLRANNINLFQFKIEGTKEPFDIPKDAILEALKILIDVRNHPILIHCKRGKHRTGSLVGCLRKFQNWCLASVFEEYKQFAGMKSRTTDLQFIEAFDLKSLRQCVYSIIYKYQGYSSSKRRLLYREEKLQKPQKTSV | 200 |
Gff information

Chromosome | Start | End | Strand | Old_gene | Gene | Num |
---|---|---|---|---|---|---|
6 | 13290970 | 13293070 | - | Sed0027892.1 | Sed06g0972 | 717515 |
Annotation information

Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
---|---|---|---|---|---|---|---|---|
Sed06g0972 | 200 | Gene3D | Protein tyrosine phosphatase superfamily | 15 | 163 | IPR029021 | - | |
Sed06g0972 | 200 | FunFam | probable tyrosine-protein phosphatase At1g05000 | 14 | 163 | - | - | |
Sed06g0972 | 200 | Pfam | Tyrosine phosphatase family | 16 | 163 | IPR004861 | - | |
Sed06g0972 | 200 | ProSiteProfiles | Dual specificity protein phosphatase domain profile. | 20 | 170 | IPR020422 | GO:0006470(InterPro) | |
Sed06g0972 | 200 | PRINTS | Plant and fungal dual specificity phosphatase signature | 87 | 101 | IPR020428 | GO:0016791(InterPro) | |
Sed06g0972 | 200 | PRINTS | Plant and fungal dual specificity phosphatase signature | 52 | 65 | IPR020428 | GO:0016791(InterPro) | |
Sed06g0972 | 200 | PRINTS | Plant and fungal dual specificity phosphatase signature | 71 | 85 | IPR020428 | GO:0016791(InterPro) | |
Sed06g0972 | 200 | PRINTS | Plant and fungal dual specificity phosphatase signature | 15 | 32 | IPR020428 | GO:0016791(InterPro) | |
Sed06g0972 | 200 | ProSitePatterns | Tyrosine specific protein phosphatases active site. | 109 | 119 | IPR016130 | GO:0016311(InterPro) | |
Sed06g0972 | 200 | PANTHER | TYROSINE-PROTEIN PHOSPHATASE | 15 | 190 | - | GO:0005737(PANTHER)|GO:0016791(PANTHER) | |
Sed06g0972 | 200 | CDD | PFA-DSP_Siw14 | 16 | 160 | - | - | |
Sed06g0972 | 200 | SUPERFAMILY | (Phosphotyrosine protein) phosphatases II | 16 | 160 | IPR029021 | - |
Duplication type information

Select | Gene1 | Location1 | Gene2 | Location2 | E-value | Duplicated-type |
---|---|---|---|---|---|---|
Sed06g0972 | Sed-Chr6:13290970 | Sed08g1212 | Sed-Chr8:25021100 | 8.00E-94 | dispersed | |
Sed06g0972 | Sed-Chr6:13290970 | Sed01g0708 | Sed-Chr1:5188054 | 7.80E-57 | transposed |
Pathway information

Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
---|---|---|---|---|---|---|
Sed06g0972 | K18045 | - | csv:101211082 | 326.635 |