Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Sed07g2703 ATGGCATATACTCTGGAGTCATGGATGAAGGAGCACAATGAAGCTTTGAAACTCTCTGAAGATATCAATGGCATGATTGCTGAGAGAAATTCACTGGCCAATTCGGAAGCTCAGCGTCAAGCCTCGGCTATACGCAGGAAGATCACGATATTGGGTACTCGACTTGATACCCTGCAGACTCAGTTACCCAAGATTCAAGGAAAGCAGCCAATACCAGAGAAAGAGATGAATCGCCGCAGGGACATGATTGGGAATTTGAGATCAAAAGCTAACCAGATGGCTTCAGCTTTGAACATGTCGAACTTTGCAAACCGTGATAGCTTACTCGGTTCAGAAATAAAGCCAGCGGATGTTATGAGCAGAACAACAGGCCTGGACAACCAAGGCCTAGTTGGGTTTCAACGACAAATTATGAGAGAGCAAGACGAAGGGCTCGAGGAACTGGAAGGGACTATAATGAGCACAAAACATATAGCATTGGCTGTCAATGAAGAACTTACACTTCACACGAGACTTATTGATGATTTAGATGAACATGTCGATGTTACAGATTCACGATTGCGGCGAGTGCAGAAGAGGCTGGCAATATTGAACAAGCGGACCAAGGGCGGTTGCACTTGCATGTCGATGATTTCATCGGTTGTCGGGATTGTCGTACTTATCACTGTTGTATGGTTACTCATCAAGCATTTGTAA 696 44.83 MAYTLESWMKEHNEALKLSEDINGMIAERNSLANSEAQRQASAIRRKITILGTRLDTLQTQLPKIQGKQPIPEKEMNRRRDMIGNLRSKANQMASALNMSNFANRDSLLGSEIKPADVMSRTTGLDNQGLVGFQRQIMREQDEGLEELEGTIMSTKHIALAVNEELTLHTRLIDDLDEHVDVTDSRLRRVQKRLAILNKRTKGGCTCMSMISSVVGIVVLITVVWLLIKHL 231
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
7 42311331 42314326 + Sed0002435.2 Sed07g2703 721567

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Sed07g2703 231 CDD SNARE_Qc 138 195 - -
Sed07g2703 231 FunFam syntaxin-51 isoform X2 137 199 - -
Sed07g2703 231 Pfam SNARE domain 172 223 IPR000727 -
Sed07g2703 231 PANTHER SYNTAXIN 14 209 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0006886(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Sed07g2703 231 Gene3D - 137 199 - -
Sed07g2703 231 SMART tSNARE_6 130 197 IPR000727 -
Sed07g2703 231 SUPERFAMILY SNARE fusion complex 126 197 - -
Sed07g2703 231 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 135 197 IPR000727 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Sed07g2703 K08503 - - csv:101208669 379.793
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Sed04g3695 Sed-Chr4:45866744 Sed07g2703 Sed-Chr7:42311331 8.10E-106 dispersed
Sed07g2703 Sed-Chr7:42311331 Sed07g2705 Sed-Chr7:42311331 7.20E-123 dispersed
Sed07g2702 Sed-Chr7:42311331 Sed07g2703 Sed-Chr7:42311331 7.20E-123 tandem
Sed07g2703 Sed-Chr7:42311331 Sed07g2704 Sed-Chr7:42311331 7.20E-123 tandem
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Sed03g1567 . 8 339 SNARE and Associated Proteins AT3G24350 64.2 2.6e-103 373.2
Sed01g1323 . 8 334 SNARE and Associated Proteins AT3G24350 64.5 1.4e-101 367.5
Sed01g1324 . 8 334 SNARE and Associated Proteins AT3G24350 64.5 1.4e-101 367.5
Sed01g1325 . 28 354 SNARE and Associated Proteins AT3G24350 64.5 1.4e-101 367.5
Sed01g1326 . 8 334 SNARE and Associated Proteins AT3G24350 64.5 1.4e-101 367.5
Sed03g1566 . 8 287 SNARE and Associated Proteins AT3G24350 61.4 3.1e-80 296.6
Sed03g2400 . 1 308 SNARE and Associated Proteins AT1G08560 69.0 3.3e-102 369.4
Sed14g0695 . 1 308 SNARE and Associated Proteins AT1G08560 69.3 3.6e-101 365.9
Sed10g0918 . 1 291 SNARE and Associated Proteins AT2G18260 52.8 2.5e-78 290.0
Sed12g1336 . 19 279 SNARE and Associated Proteins AT3G11820 80.5 1.5e-115 413.7
Sed01g2057 . 31 282 SNARE and Associated Proteins AT3G11820 66.7 2.4e-92 336.7
Sed08g2301 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 1.5e-91 334.0
Sed14g0266 . 28 276 SNARE and Associated Proteins AT3G11820 68.3 2.9e-90 329.7
Sed14g0267 . 28 276 SNARE and Associated Proteins AT3G11820 68.3 2.9e-90 329.7
Sed12g1058 . 24 284 SNARE and Associated Proteins AT3G11820 52.9 3.3e-70 263.1
Sed02g0884 . 25 283 SNARE and Associated Proteins AT3G11820 51.4 2.2e-66 250.4
Sed12g1060 . 24 230 SNARE and Associated Proteins AT3G11820 50.7 7.0e-52 202.2
Sed12g1059 . 24 228 SNARE and Associated Proteins AT3G11820 50.7 4.5e-51 199.5
Sed12g1336 . 30 279 SNARE and Associated Proteins AT3G52400 68.8 2.7e-89 326.6
Sed01g2057 . 1 282 SNARE and Associated Proteins AT3G52400 57.2 4.5e-81 299.3
Sed08g2301 . 1 281 SNARE and Associated Proteins AT3G52400 55.0 9.5e-79 291.6
Sed14g0266 . 28 276 SNARE and Associated Proteins AT3G52400 61.0 6.8e-77 285.4
Sed14g0267 . 28 276 SNARE and Associated Proteins AT3G52400 61.0 6.8e-77 285.4
Sed08g2301 . 1 295 SNARE and Associated Proteins AT4G03330 69.5 2.5e-107 386.3
Sed01g2057 . 1 300 SNARE and Associated Proteins AT4G03330 67.3 5.3e-105 378.6
Sed12g1336 . 1 279 SNARE and Associated Proteins AT4G03330 57.5 1.4e-81 300.8
Sed12g1058 . 1 284 SNARE and Associated Proteins AT4G03330 53.1 3.8e-71 266.2
Sed14g0266 . 28 274 SNARE and Associated Proteins AT4G03330 52.2 2.0e-67 253.8
Sed14g0267 . 28 274 SNARE and Associated Proteins AT4G03330 52.2 2.0e-67 253.8
Sed02g0884 . 1 283 SNARE and Associated Proteins AT4G03330 50.2 4.4e-67 252.7
Sed12g1060 . 1 230 SNARE and Associated Proteins AT4G03330 51.7 3.6e-53 206.5
Sed08g2301 . 1 303 SNARE and Associated Proteins AT1G61290 79.2 7.5e-128 454.5
Sed01g2057 . 1 304 SNARE and Associated Proteins AT1G61290 77.6 2.7e-125 446.0
Sed12g1336 . 1 279 SNARE and Associated Proteins AT1G61290 61.9 8.1e-90 328.2
Sed14g0266 . 1 292 SNARE and Associated Proteins AT1G61290 52.5 1.3e-76 284.3
Sed14g0267 . 1 292 SNARE and Associated Proteins AT1G61290 52.5 1.3e-76 284.3
Sed08g2301 . 1 303 SNARE and Associated Proteins AT1G11250 77.9 2.9e-124 442.6
Sed01g2057 . 1 304 SNARE and Associated Proteins AT1G11250 76.3 2.7e-122 436.0
Sed12g1336 . 1 279 SNARE and Associated Proteins AT1G11250 61.6 1.9e-91 333.6
Sed14g0266 . 1 287 SNARE and Associated Proteins AT1G11250 54.7 2.0e-80 297.0
Sed14g0267 . 1 287 SNARE and Associated Proteins AT1G11250 54.7 2.0e-80 297.0
Sed02g0884 . 1 283 SNARE and Associated Proteins AT1G11250 50.5 7.0e-70 261.9
Sed12g1058 . 1 284 SNARE and Associated Proteins AT1G11250 50.7 2.7e-69 260.0
Sed12g1058 . 1 307 SNARE and Associated Proteins AT3G03800 72.6 2.5e-115 412.9
Sed02g0884 . 1 306 SNARE and Associated Proteins AT3G03800 73.7 2.4e-113 406.4
Sed12g1060 . 1 230 SNARE and Associated Proteins AT3G03800 71.3 1.9e-86 317.0
Sed12g1059 . 1 228 SNARE and Associated Proteins AT3G03800 71.5 1.2e-85 314.3
Sed02g0885 . 1 229 SNARE and Associated Proteins AT3G03800 73.2 6.1e-85 312.0
Sed02g0886 . 1 229 SNARE and Associated Proteins AT3G03800 73.2 6.1e-85 312.0
Sed02g0887 . 1 229 SNARE and Associated Proteins AT3G03800 73.2 6.1e-85 312.0
Sed05g3073 . 47 320 SNARE and Associated Proteins AT3G03800 57.3 2.4e-81 300.1
Sed12g1058 . 1 202 SNARE and Associated Proteins AT5G08080 75.2 2.2e-76 283.1
Sed12g1059 . 1 202 SNARE and Associated Proteins AT5G08080 75.2 2.2e-76 283.1
Sed12g1060 . 1 202 SNARE and Associated Proteins AT5G08080 75.2 2.2e-76 283.1
Sed02g0884 . 1 201 SNARE and Associated Proteins AT5G08080 75.4 2.7e-74 276.2
Sed02g0885 . 1 201 SNARE and Associated Proteins AT5G08080 75.4 2.7e-74 276.2
Sed02g0886 . 1 201 SNARE and Associated Proteins AT5G08080 75.4 2.7e-74 276.2
Sed02g0887 . 1 201 SNARE and Associated Proteins AT5G08080 75.4 2.7e-74 276.2
Sed05g3073 . 29 219 SNARE and Associated Proteins AT5G08080 58.6 2.1e-50 196.8
Sed02g0066 . 66 321 SNARE and Associated Proteins AT5G16830 59.5 1.0e-75 281.2
Sed04g0861 . 1 255 SNARE and Associated Proteins AT5G16830 60.3 2.6e-74 276.6
Sed02g0067 . 66 318 SNARE and Associated Proteins AT5G16830 59.5 2.6e-74 276.6
Sed02g0066 . 66 321 SNARE and Associated Proteins AT5G46860 64.5 6.3e-78 288.5
Sed04g0861 . 1 255 SNARE and Associated Proteins AT5G46860 65.6 2.4e-77 286.6
Sed02g0067 . 66 318 SNARE and Associated Proteins AT5G46860 64.4 1.6e-76 283.9
Sed02g0066 . 66 321 SNARE and Associated Proteins AT4G17730 60.2 1.2e-73 274.2
Sed02g0067 . 66 307 SNARE and Associated Proteins AT4G17730 62.3 2.1e-73 273.5
Sed04g0861 . 1 255 SNARE and Associated Proteins AT4G17730 60.5 1.2e-70 264.2
Sed02g0066 . 130 321 SNARE and Associated Proteins AT1G32270 60.9 2.0e-52 204.1
Sed02g0067 . 130 322 SNARE and Associated Proteins AT1G32270 60.1 7.6e-52 202.2
Sed04g0861 . 65 255 SNARE and Associated Proteins AT1G32270 58.1 2.1e-49 194.1
Sed07g2558 . 1 334 SNARE and Associated Proteins AT5G05760 65.7 8.4e-112 401.4
Sed04g2893 . 1 334 SNARE and Associated Proteins AT5G05760 63.8 3.3e-108 389.4
Sed07g2559 . 1 218 SNARE and Associated Proteins AT5G05760 59.0 2.6e-60 230.3
Sed03g1567 . 8 339 SNARE and Associated Proteins AT3G24350 64.2 2.6e-103 373.2
Sed01g1323 . 8 334 SNARE and Associated Proteins AT3G24350 64.5 1.4e-101 367.5
Sed01g1324 . 8 334 SNARE and Associated Proteins AT3G24350 64.5 1.4e-101 367.5
Sed01g1325 . 28 354 SNARE and Associated Proteins AT3G24350 64.5 1.4e-101 367.5
Sed01g1326 . 8 334 SNARE and Associated Proteins AT3G24350 64.5 1.4e-101 367.5
Sed03g1566 . 8 287 SNARE and Associated Proteins AT3G24350 61.4 3.1e-80 296.6
Sed03g1942 . 1 327 SNARE and Associated Proteins AT5G26980 74.6 6.3e-125 444.9
Sed11g0395 . 1 325 SNARE and Associated Proteins AT5G26980 75.4 6.3e-125 444.9
Sed07g0550 . 1 320 SNARE and Associated Proteins AT5G26980 66.5 8.0e-104 374.8
Sed11g0396 . 1 244 SNARE and Associated Proteins AT5G26980 73.8 2.8e-88 323.2
Sed03g1943 . 1 246 SNARE and Associated Proteins AT5G26980 72.8 8.1e-88 321.6
Sed07g0551 . 1 245 SNARE and Associated Proteins AT5G26980 61.6 3.8e-69 259.6
Sed07g0550 . 1 320 SNARE and Associated Proteins AT4G02195 66.1 2.5e-105 379.8
Sed03g1942 . 1 329 SNARE and Associated Proteins AT4G02195 62.8 2.0e-102 370.2
Sed11g0395 . 1 327 SNARE and Associated Proteins AT4G02195 62.6 9.9e-102 367.9
Sed07g0551 . 1 259 SNARE and Associated Proteins AT4G02195 57.8 1.8e-71 267.3
Sed03g1943 . 1 246 SNARE and Associated Proteins AT4G02195 60.1 5.5e-68 255.8
Sed11g0396 . 1 244 SNARE and Associated Proteins AT4G02195 59.3 2.3e-66 250.4
Sed03g1942 . 1 328 SNARE and Associated Proteins AT3G05710 75.4 8.2e-128 454.5
Sed11g0395 . 1 326 SNARE and Associated Proteins AT3G05710 74.8 7.7e-126 448.0
Sed07g0550 . 1 320 SNARE and Associated Proteins AT3G05710 63.7 3.6e-99 359.4
Sed03g1943 . 1 246 SNARE and Associated Proteins AT3G05710 72.1 3.4e-89 326.2
Sed11g0396 . 1 244 SNARE and Associated Proteins AT3G05710 71.3 1.1e-87 321.2
Sed07g0551 . 1 241 SNARE and Associated Proteins AT3G05710 58.7 4.4e-65 246.1
Sed04g3695 . 1 233 SNARE and Associated Proteins AT1G16240 70.8 1.3e-87 320.5
Sed07g2702 . 1 231 SNARE and Associated Proteins AT1G16240 72.1 2.2e-87 319.7
Sed07g2703 . 1 231 SNARE and Associated Proteins AT1G16240 72.1 2.2e-87 319.7
Sed07g2704 . 1 231 SNARE and Associated Proteins AT1G16240 72.1 2.2e-87 319.7
Sed07g2705 . 1 231 SNARE and Associated Proteins AT1G16240 72.1 2.2e-87 319.7
Sed07g2702 . 1 231 SNARE and Associated Proteins AT1G79590 71.2 2.5e-87 319.7
Sed07g2703 . 1 231 SNARE and Associated Proteins AT1G79590 71.2 2.5e-87 319.7
Sed07g2704 . 1 231 SNARE and Associated Proteins AT1G79590 71.2 2.5e-87 319.7
Sed07g2705 . 1 231 SNARE and Associated Proteins AT1G79590 71.2 2.5e-87 319.7
Sed04g3695 . 1 233 SNARE and Associated Proteins AT1G79590 70.4 9.6e-87 317.8
Sed10g1784 . 48 240 SNARE and Associated Proteins AT1G28490 69.9 1.6e-65 246.9
Sed10g1783 . 56 247 SNARE and Associated Proteins AT1G28490 69.3 1.7e-64 243.4
Sed10g1785 . 56 247 SNARE and Associated Proteins AT1G28490 69.3 1.7e-64 243.4
Sed06g0902 . 56 246 SNARE and Associated Proteins AT1G28490 69.6 3.9e-64 242.3
Sed06g0903 . 56 246 SNARE and Associated Proteins AT1G28490 69.6 3.9e-64 242.3
Sed04g1347 . 1 264 SNARE and Associated Proteins AT3G09740 77.4 4.7e-110 395.2
Sed05g2859 . 46 308 SNARE and Associated Proteins AT3G09740 66.8 1.1e-93 340.9
Sed04g1347 . 1 264 SNARE and Associated Proteins AT3G45280 62.9 2.8e-86 316.2
Sed05g2859 . 46 308 SNARE and Associated Proteins AT3G45280 63.8 2.8e-86 316.2
Sed04g1347 . 1 261 SNARE and Associated Proteins AT3G61450 67.0 1.5e-92 337.0
Sed05g2859 . 46 305 SNARE and Associated Proteins AT3G61450 59.0 2.8e-83 306.2
Sed03g0404 . 65 310 SNARE and Associated Proteins AT1G51740 76.6 4.0e-95 345.5
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002063 3 5 2 3 2 1 3 1 2 1 1 1 3 2 2 3 1 4 3 1 2 2 1 2 2 2 1 5 3 1 65