Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Sed08g1212 ATGAGGGTTGAATCGAAGGAAGGCGATTCCGGCGATGTTGTTCTTGTTCCTCCGACCAATTTCTCGATGGTCGAGGATGGCATTTTCCGATCCGGATTCCCTCAGCCCCCCAATTTCCCCTTCCTCGTTAACCTCAATCTCCGCTCCATTATATACTTGTGTCCAGAACCCTACCCAGAGGAGAATTTGGAGTTTCTTAGAGCTAATAACATCCAGCTTTTTCAATTCAAAATTGAAGGGACAAAGGAGCCATCTGTTTTGATTCGAAAGGAAGCTATCCTTGAGGCCCTAAAAATCCTAATTGATGTTAGGAATCACCCCATTTTGATCCACTGCAAGCGTGGAAAGCACCGAACAGGCTCGCTCGTTGGTTGCCTGAGAAAGTTTCAGAACTGGTGCTTGTCTTCAGTGTTCGAGGAGTACCAGCGATTCGCAGGCATGAAGTCGAGGGCGACGGATCTACAATTCATCGAGACATTCAACATTGCCTCTCTGAGGCAATGTGTTTACAGCATCATATACCAGTACCAAGGCTACAACTCAAAAAAGAGAAGGCTGATGTATAGAGAAGAAAATTTGCAGAAACCCCAAAAAACAGCAGTTTAG 606 45.54 MRVESKEGDSGDVVLVPPTNFSMVEDGIFRSGFPQPPNFPFLVNLNLRSIIYLCPEPYPEENLEFLRANNIQLFQFKIEGTKEPSVLIRKEAILEALKILIDVRNHPILIHCKRGKHRTGSLVGCLRKFQNWCLSSVFEEYQRFAGMKSRATDLQFIETFNIASLRQCVYSIIYQYQGYNSKKRRLMYREENLQKPQKTAV 201
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
8 25021100 25023489 - Sed0009769.1 Sed08g1212 722988

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Sed08g1212 201 FunFam probable tyrosine-protein phosphatase At1g05000 14 164 - -
Sed08g1212 201 PRINTS Plant and fungal dual specificity phosphatase signature 71 85 IPR020428 GO:0016791(InterPro)
Sed08g1212 201 PRINTS Plant and fungal dual specificity phosphatase signature 88 102 IPR020428 GO:0016791(InterPro)
Sed08g1212 201 PRINTS Plant and fungal dual specificity phosphatase signature 15 32 IPR020428 GO:0016791(InterPro)
Sed08g1212 201 PRINTS Plant and fungal dual specificity phosphatase signature 52 65 IPR020428 GO:0016791(InterPro)
Sed08g1212 201 CDD PFA-DSP_Siw14 15 161 - -
Sed08g1212 201 SUPERFAMILY (Phosphotyrosine protein) phosphatases II 15 159 IPR029021 -
Sed08g1212 201 Gene3D Protein tyrosine phosphatase superfamily 14 164 IPR029021 -
Sed08g1212 201 Pfam Tyrosine phosphatase family 15 164 IPR004861 -
Sed08g1212 201 ProSitePatterns Tyrosine specific protein phosphatases active site. 110 120 IPR016130 GO:0016311(InterPro)
Sed08g1212 201 PANTHER TYROSINE-PROTEIN PHOSPHATASE 14 192 - GO:0005737(PANTHER)|GO:0016791(PANTHER)
Sed08g1212 201 ProSiteProfiles Dual specificity protein phosphatase domain profile. 20 185 IPR020422 GO:0006470(InterPro)
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Sed08g1212 K18045 - - csv:101211082 339.732
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Sed05g3223 Sed-Chr5:41876659 Sed08g1212 Sed-Chr8:25021100 4.40E-58 dispersed
Sed06g0972 Sed-Chr6:13290970 Sed08g1212 Sed-Chr8:25021100 8.00E-94 dispersed
Sed08g1212 Sed-Chr8:25021100 Sed01g0708 Sed-Chr1:5188054 4.10E-58 transposed
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Sed10g0663 . 33 605 Protein tyrosine phosphatase (PTP) family AT3G50110 60.9 5.5e-189 658.7
Sed10g0664 . 33 605 Protein tyrosine phosphatase (PTP) family AT3G50110 60.9 5.5e-189 658.7
Sed10g1999 . 20 610 Protein tyrosine phosphatase (PTP) family AT3G50110 56.5 1.2e-180 630.9
Sed14g0871 . 33 595 Protein tyrosine phosphatase (PTP) family AT3G50110 58.7 6.1e-180 628.6
Sed05g2595 . 42 611 Protein tyrosine phosphatase (PTP) family AT3G50110 56.5 1.8e-176 617.1
Sed05g2596 . 42 611 Protein tyrosine phosphatase (PTP) family AT3G50110 56.5 1.8e-176 617.1
Sed05g2597 . 42 611 Protein tyrosine phosphatase (PTP) family AT3G50110 56.5 1.8e-176 617.1
Sed05g2598 . 42 611 Protein tyrosine phosphatase (PTP) family AT3G50110 56.5 1.8e-176 617.1
Sed14g0872 . 33 631 Protein tyrosine phosphatase (PTP) family AT3G50110 52.6 7.0e-160 562.0
Sed14g0873 . 33 417 Protein tyrosine phosphatase (PTP) family AT3G50110 70.0 5.0e-158 555.8
Sed10g0665 . 1 460 Protein tyrosine phosphatase (PTP) family AT3G50110 61.5 3.0e-155 546.6
Sed04g3520 . 1 406 Protein tyrosine phosphatase (PTP) family AT5G39400 65.7 4.4e-155 545.4
Sed01g2862 . 1 854 Protein tyrosine phosphatase (PTP) family AT3G10550 69.3 0.0e+00 1172.5
Sed03g0609 . 1 868 Protein tyrosine phosphatase (PTP) family AT3G10550 66.7 0.0e+00 1142.9
Sed01g2863 . 3 764 Protein tyrosine phosphatase (PTP) family AT3G10550 70.0 2.6e-311 1065.4
Sed01g2862 . 1 854 Protein tyrosine phosphatase (PTP) family AT5G04540 65.6 0.0e+00 1110.1
Sed03g0609 . 1 868 Protein tyrosine phosphatase (PTP) family AT5G04540 63.5 6.8e-314 1073.5
Sed01g2863 . 4 764 Protein tyrosine phosphatase (PTP) family AT5G04540 66.7 2.0e-295 1012.7
Sed12g2294 . 1 1135 Protein tyrosine phosphatase (PTP) family AT5G58160 52.9 0.0e+00 1083.9
Sed05g1740 . 1 1349 Protein tyrosine phosphatase (PTP) family AT5G58160 51.0 1.0e-303 1040.8
Sed05g1741 . 1 1289 Protein tyrosine phosphatase (PTP) family AT5G58160 50.5 3.9e-279 959.1
Sed10g1774 . 75 390 Protein tyrosine phosphatase (PTP) family AT1G71860 66.6 7.6e-121 431.4
Sed12g2546 . 27 937 Protein tyrosine phosphatase (PTP) family AT5G23720 60.5 8.3e-287 984.2
Sed04g1865 . 33 172 Protein tyrosine phosphatase (PTP) family AT3G06110 57.1 7.8e-42 167.9
Sed04g1863 . 33 172 Protein tyrosine phosphatase (PTP) family AT3G06110 57.1 7.8e-42 167.9
Sed04g3441 . 1 166 Protein tyrosine phosphatase (PTP) family AT2G04550 78.1 7.7e-72 267.7
Sed04g3442 . 1 166 Protein tyrosine phosphatase (PTP) family AT2G04550 78.1 7.7e-72 267.7
Sed05g1887 . 1 166 Protein tyrosine phosphatase (PTP) family AT2G04550 76.3 2.5e-70 262.7
Sed06g2006 . 103 384 Protein tyrosine phosphatase (PTP) family AT3G52180 69.9 2.0e-114 409.8
Sed07g2221 . 94 378 Protein tyrosine phosphatase (PTP) family AT3G52180 69.5 1.7e-113 406.8
Sed07g2222 . 94 378 Protein tyrosine phosphatase (PTP) family AT3G52180 69.5 1.7e-113 406.8
Sed04g0349 . 5 284 Protein tyrosine phosphatase (PTP) family AT3G10940 65.7 1.2e-106 384.0
Sed06g0547 . 146 594 Protein tyrosine phosphatase (PTP) family AT3G01510 71.9 2.4e-199 692.6
Sed06g0548 . 2 450 Protein tyrosine phosphatase (PTP) family AT3G01510 71.9 2.4e-199 692.6
Sed01g0708 . 8 208 Protein tyrosine phosphatase (PTP) family AT2G32960 58.6 5.3e-74 275.4
Sed05g1892 . 38 234 Protein tyrosine phosphatase (PTP) family AT2G32960 65.8 7.7e-73 271.6
Sed04g3433 . 6 238 Protein tyrosine phosphatase (PTP) family AT2G32960 56.8 1.0e-72 271.2
Sed05g3223 . 10 212 Protein tyrosine phosphatase (PTP) family AT2G32960 59.8 1.3e-72 270.8
Sed05g1893 . 38 204 Protein tyrosine phosphatase (PTP) family AT2G32960 64.9 5.5e-71 265.4
Sed04g1684 . 1 333 Protein tyrosine phosphatase (PTP) family AT2G35680 55.1 4.8e-99 359.0
Sed03g1757 . 17 263 Protein tyrosine phosphatase (PTP) family AT2G35680 54.2 2.7e-78 290.0
Sed03g1757 . 27 218 Protein tyrosine phosphatase (PTP) family AT5G56610 51.0 4.4e-46 182.2
Sed01g0708 . 18 208 Protein tyrosine phosphatase (PTP) family AT4G03960 70.2 1.5e-76 283.5
Sed05g3223 . 25 212 Protein tyrosine phosphatase (PTP) family AT4G03960 71.3 1.7e-75 280.0
Sed05g1893 . 34 204 Protein tyrosine phosphatase (PTP) family AT4G03960 75.4 1.8e-74 276.6
Sed05g1892 . 34 234 Protein tyrosine phosphatase (PTP) family AT4G03960 64.2 1.0e-69 260.8
Sed04g3433 . 39 238 Protein tyrosine phosphatase (PTP) family AT4G03960 63.0 5.2e-69 258.5
Sed08g1212 . 5 171 Protein tyrosine phosphatase (PTP) family AT4G03960 59.9 8.6e-56 214.5
Sed06g0972 . 14 183 Protein tyrosine phosphatase (PTP) family AT4G03960 56.1 2.3e-53 206.5
Sed08g1212 . 1 200 Protein tyrosine phosphatase (PTP) family AT3G02800 67.0 4.0e-77 285.4
Sed06g0972 . 3 196 Protein tyrosine phosphatase (PTP) family AT3G02800 65.6 1.2e-73 273.9
Sed01g0708 . 34 202 Protein tyrosine phosphatase (PTP) family AT3G02800 58.6 4.7e-57 218.8
Sed05g3223 . 43 209 Protein tyrosine phosphatase (PTP) family AT3G02800 60.5 5.1e-56 215.3
Sed05g1893 . 40 193 Protein tyrosine phosphatase (PTP) family AT3G02800 63.0 8.8e-56 214.5
Sed05g1892 . 40 223 Protein tyrosine phosphatase (PTP) family AT3G02800 52.7 5.0e-51 198.7
Sed04g3433 . 44 227 Protein tyrosine phosphatase (PTP) family AT3G02800 51.1 1.6e-49 193.7
Sed07g2453 . 1 189 Protein tyrosine phosphatase (PTP) family AT3G55270 65.3 1.5e-63 242.3
Sed04g2798 . 20 188 Protein tyrosine phosphatase (PTP) family AT3G55270 67.1 4.5e-60 230.7
Sed04g2799 . 20 188 Protein tyrosine phosphatase (PTP) family AT3G55270 67.1 4.5e-60 230.7
Sed04g3520 . 1 406 Protein tyrosine phosphatase (PTP) family AT5G39400 65.7 4.4e-155 545.4
Sed05g2595 . 32 611 Protein tyrosine phosphatase (PTP) family AT3G19420 65.3 4.6e-217 751.9
Sed05g2596 . 32 611 Protein tyrosine phosphatase (PTP) family AT3G19420 65.3 4.6e-217 751.9
Sed05g2597 . 32 611 Protein tyrosine phosphatase (PTP) family AT3G19420 65.3 4.6e-217 751.9
Sed05g2598 . 32 611 Protein tyrosine phosphatase (PTP) family AT3G19420 65.3 4.6e-217 751.9
Sed10g1999 . 8 610 Protein tyrosine phosphatase (PTP) family AT3G19420 63.5 7.8e-217 751.1
Sed10g0663 . 31 605 Protein tyrosine phosphatase (PTP) family AT3G19420 62.5 3.9e-200 695.7
Sed10g0664 . 31 605 Protein tyrosine phosphatase (PTP) family AT3G19420 62.5 3.9e-200 695.7
Sed14g0871 . 33 595 Protein tyrosine phosphatase (PTP) family AT3G19420 59.5 4.8e-190 662.1
Sed14g0872 . 33 631 Protein tyrosine phosphatase (PTP) family AT3G19420 53.6 1.9e-170 597.0
Sed14g0873 . 33 419 Protein tyrosine phosphatase (PTP) family AT3G19420 70.9 8.2e-166 581.6
Sed10g0665 . 1 460 Protein tyrosine phosphatase (PTP) family AT3G19420 64.1 3.1e-165 579.7
Sed10g0663 . 33 605 Protein tyrosine phosphatase (PTP) family AT3G50110 60.9 5.5e-189 658.7
Sed10g0664 . 33 605 Protein tyrosine phosphatase (PTP) family AT3G50110 60.9 5.5e-189 658.7
Sed10g1999 . 20 610 Protein tyrosine phosphatase (PTP) family AT3G50110 56.5 1.2e-180 630.9
Sed14g0871 . 33 595 Protein tyrosine phosphatase (PTP) family AT3G50110 58.7 6.1e-180 628.6
Sed05g2595 . 42 611 Protein tyrosine phosphatase (PTP) family AT3G50110 56.5 1.8e-176 617.1
Sed05g2596 . 42 611 Protein tyrosine phosphatase (PTP) family AT3G50110 56.5 1.8e-176 617.1
Sed05g2597 . 42 611 Protein tyrosine phosphatase (PTP) family AT3G50110 56.5 1.8e-176 617.1
Sed05g2598 . 42 611 Protein tyrosine phosphatase (PTP) family AT3G50110 56.5 1.8e-176 617.1
Sed14g0872 . 33 631 Protein tyrosine phosphatase (PTP) family AT3G50110 52.6 7.0e-160 562.0
Sed14g0873 . 33 417 Protein tyrosine phosphatase (PTP) family AT3G50110 70.0 5.0e-158 555.8
Sed10g0665 . 1 460 Protein tyrosine phosphatase (PTP) family AT3G50110 61.5 3.0e-155 546.6
Sed12g2294 . 1 1135 Protein tyrosine phosphatase (PTP) family AT5G58160 52.9 0.0e+00 1083.9
Sed05g1740 . 1 1349 Protein tyrosine phosphatase (PTP) family AT5G58160 51.0 1.0e-303 1040.8
Sed05g1741 . 1 1289 Protein tyrosine phosphatase (PTP) family AT5G58160 50.5 3.9e-279 959.1
Sed01g2862 . 1 854 Protein tyrosine phosphatase (PTP) family AT3G10550 69.3 0.0e+00 1172.5
Sed03g0609 . 1 868 Protein tyrosine phosphatase (PTP) family AT3G10550 66.7 0.0e+00 1142.9
Sed01g2863 . 3 764 Protein tyrosine phosphatase (PTP) family AT3G10550 70.0 2.6e-311 1065.4
Sed01g2862 . 1 854 Protein tyrosine phosphatase (PTP) family AT5G04540 65.6 0.0e+00 1110.1
Sed03g0609 . 1 868 Protein tyrosine phosphatase (PTP) family AT5G04540 63.5 6.8e-314 1073.5
Sed01g2863 . 4 764 Protein tyrosine phosphatase (PTP) family AT5G04540 66.7 2.0e-295 1012.7
Sed05g1208 . 64 244 Protein tyrosine phosphatase (PTP) family AT3G44620 63.9 9.9e-68 254.6
Sed05g1209 . 64 172 Protein tyrosine phosphatase (PTP) family AT3G44620 73.6 8.7e-40 161.8
Sed04g0821 . 24 319 Protein tyrosine phosphatase (PTP) family AT2G35320 62.5 3.6e-109 392.5
Sed04g0822 . 24 319 Protein tyrosine phosphatase (PTP) family AT2G35320 62.5 3.6e-109 392.5
Sed14g0659 . 1 674 Protein tyrosine phosphatase (PTP) family AT3G09100 70.8 4.3e-285 978.0
Sed14g0660 . 1 674 Protein tyrosine phosphatase (PTP) family AT3G09100 70.8 4.3e-285 978.0
Sed14g0659 . 5 674 Protein tyrosine phosphatase (PTP) family AT5G01290 65.4 1.9e-256 882.9
Sed14g0660 . 5 674 Protein tyrosine phosphatase (PTP) family AT5G01290 65.4 1.9e-256 882.9
Sed14g0659 . 78 674 Protein tyrosine phosphatase (PTP) family AT5G28210 57.2 2.3e-187 653.3
Sed14g0660 . 78 674 Protein tyrosine phosphatase (PTP) family AT5G28210 57.2 2.3e-187 653.3
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0008556 1 1 1 1 1 1 2 1 1 1 1 1 2 1 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 1 35