Cucurbitales platform

Gene search

Sequence information

Select	Gene	Cds	Cds_length	GC_content	Pep	Pep_length
	Sed08g2078	ATGGCCACTGTCATGACCCAGGCTTCTGCCGCTGTCTTCCGGCCGTGCGCGTCGAGATCCAGGTTTCTTTCTGGGTCGTCGGGAAAGTTTAACCGAGCTTTGTACGTTAAGCCAGCAACTTCTTCGGTTCCTTGTGCTTTCAAAGTAGAGGCCAAGAAAGGAGAGTGGTTACCAGGTTTGCCATCACCAGCTTACCTTGATGGCAGTCTAGCAGGTGACAATGGATTTGACCCCTTGGGACTTGCAGAGGACCCTGAAAACTTGAGGTGGTATGTGCAAGCAGAGCTCGTGAACGGCCGATGGGCGATGCTCGGAGTTGCGGGAATGCTATTACCTGAAGTCCTCACAAGTTTCGGAATCATCAACGTACCGAAATGGTACGATGCTGGGAAAGCCGAGTATTTCGCATCGTCGTCGACTCTGTTTGTGATCGAGTTCATTCTGTTCCACTATGTGGAAATCAGAAGATGGCAAGACATAAAGAACCCAGGAAGTGTAAACCAAGATCCCATTTTCAAGCAATACAGCTTGCCACCAAATGATGTTGGATATCCAGGGGGAATTTTCAACCCACTCAACTTTCAACCAACTCTTGAAGCCAAGGAAAAGGAGATTGCTAATGGAAGATTGGCAATGTTGGCATTCTTGGGATTCATTATTCAACACAATGTGACTGGAAAAGGTCCATTTGACAACTTTTTGCAGCACATTTCAGATCCATGGCACAACACTATTGTTCAGACACTAAGTGGATAA	756	47.09	MATVMTQASAAVFRPCASRSRFLSGSSGKFNRALYVKPATSSVPCAFKVEAKKGEWLPGLPSPAYLDGSLAGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVLTSFGIINVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNDVGYPGGIFNPLNFQPTLEAKEKEIANGRLAMLAFLGFIIQHNVTGKGPFDNFLQHISDPWHNTIVQTLSG	251

Gff information

Chromosome	Start	End	Strand	Old_gene	Gene	Num
8	34963279	34964755	-	Sed0020579.1	Sed08g2078	723854

Annotation

Seq ID	Length	Analysis	Description	Start	End	IPR	GO
Sed08g2078	251	SUPERFAMILY	Chlorophyll a-b binding protein	52	249	-	-
Sed08g2078	251	PANTHER	CHLOROPHYLL A/B BINDING PROTEIN	14	245	IPR001344	GO:0009416(PANTHER)\|GO:0009765(InterPro)\|GO:0009768(PANTHER)\|GO:0016020(InterPro)
Sed08g2078	251	Gene3D	Chlorophyll a/b binding protein domain	63	242	-	-
Sed08g2078	251	FunFam	Chlorophyll a-b binding protein, chloroplastic	63	242	-	-
Sed08g2078	251	Pfam	Chlorophyll A-B binding protein	63	222	IPR022796	-

Pathway

Select	Query	KO	Definition	Second KO	KEGG Genes ID	GHOSTX Score
	Sed08g2078	K08910	-	-	csv:101218675	489.96

Dupl-types

Gene1	Location1	Gene2	Location2	E-value	Duplicated-type
Sed08g2078	Sed-Chr8:34963279	Sed12g1695	Sed-Chr12:28189246	2.70E-54	dispersed
Sed11g0951	Sed-Chr11:23937939	Sed08g2078	Sed-Chr8:34963279	1.10E-53	transposed
Sed01g2387	Sed-Chr1:17929741	Sed08g2078	Sed-Chr8:34963279	3.20E-31	wgd
Sed12g1956	Sed-Chr12:30606377	Sed08g2078	Sed-Chr8:34963279	2.20E-125	wgd
Sed08g0226	Sed-Chr8:1288558	Sed08g2078	Sed-Chr8:34963279	3.00E-130	wgd

Deco-Alignment

Select	Vvi1	Blo1	Blo2	Bda1	Bda2	Bpe1	Bpe2	Bma1	Bma2	Cmo1	Cmo2	Cma1	Cma2	Car1	Car2	Sed1	Cpe1	Cpe2	Bhi1	Tan1	Cmetu1	Lac1	Hepe1	Mch1	Lcy1	Cla1	Cam1	Cec1	Cco1	Clacu1	Cmu1	Cre1	Cone1	Cone2	Cone3	Cone4	Lsi1	Csa1	Chy1	Cme1	Blo3	Blo4	Bda3	Bda4	Bpe3	Bpe4	Bma3	Bma4	Sed2	Cmo3	Cmo4	Cma3	Cma4	Car3	Car4	Cpe3	Cpe4	Bhi2	Tan2	Cmetu2	Lac2	Hepe2	Mch2	Lcy2	Cla2	Cam2	Cec2	Cco2	Clacu2	Cmu2	Cre2	Lsi2	Csa2	Chy2	Cme2
	Vvi17g566	Blo04g00773	.	Bda06g00542	Bda15g00608	Bpe12g00541	.	.	Bma12g00994	.	.	.	Cma11g00139	Car10g00187	Car11g00156	.	.	Cpe04g01495	.	.	.	.	.	.	.	Cla06g01586	Cam06g1755	Cec06g1811	Cco06g1814	Clacu06g1721	Cmu06g1664	Cre06g2478	Cone2ag0840	Cone16ag0175	.	.	Lsi02g00081	Csa01g00560	Chy12g01533	Cme12g01983	Blo13g00003	Blo15g00312	.	.	Bpe07g00779	.	.	Bma08g00227	Sed08g2078	Cmo10g00213	Cmo11g00172	.	.	.	.	.	Cpe18g00788	Bhi08g01147	Tan05g2431	Cmetu02g0368	Lac10g0087	Hepe07g2501	.	.	Cla04g01190	Cam04g1247	Cec01g1758	Cco01g1804	Clacu04g1276	Cmu04g1254	Cre01g1547	.	Csa01g00241	Chy02g02491	Cme02g01877

Syn-Families

Gene	Event_type	S_start	S_end	Function	Ath_gene	Identity(%)	E-value	Score
Sed13g1378	.	1	441	Chloroplast and Mitochondria Gene Families	AT2G28800	61.8	1.2e-134	477.6
Sed04g0012	.	71	408	Chloroplast and Mitochondria Gene Families	AT2G28800	56.1	6.8e-98	355.5
Sed04g0013	.	1	295	Chloroplast and Mitochondria Gene Families	AT2G28800	57.3	1.4e-87	321.2
Sed10g1833	.	3	256	Chloroplast and Mitochondria Gene Families	AT1G15820	79.2	8.7e-117	417.5
Sed10g1832	.	3	256	Chloroplast and Mitochondria Gene Families	AT1G15820	79.2	1.9e-116	416.4
Sed05g2091	.	1	265	Chloroplast and Mitochondria Gene Families	AT3G27690	89.1	6.2e-143	504.6
Sed04g3726	.	1	264	Chloroplast and Mitochondria Gene Families	AT3G27690	87.2	4.9e-140	495.0
Sed10g0156	.	2	267	Chloroplast and Mitochondria Gene Families	AT3G27690	76.5	4.3e-120	428.7
Sed10g0157	.	2	266	Chloroplast and Mitochondria Gene Families	AT3G27690	76.8	7.4e-120	427.9
Sed10g0155	.	2	266	Chloroplast and Mitochondria Gene Families	AT3G27690	76.8	9.7e-120	427.6
Sed14g1562	.	2	268	Chloroplast and Mitochondria Gene Families	AT3G27690	76.1	1.6e-119	426.8
Sed14g1563	.	2	268	Chloroplast and Mitochondria Gene Families	AT3G27690	76.1	1.6e-119	426.8
Sed01g2226	.	2	265	Chloroplast and Mitochondria Gene Families	AT3G27690	76.7	1.4e-118	423.7
Sed05g1289	.	179	446	Chloroplast and Mitochondria Gene Families	AT3G27690	74.5	2.6e-117	419.5
Sed01g0736	.	2	262	Chloroplast and Mitochondria Gene Families	AT3G27690	76.4	5.0e-116	415.2
Sed06g1212	.	28	247	Chloroplast and Mitochondria Gene Families	AT3G27690	86.8	2.5e-115	412.9
Sed05g1288	.	19	244	Chloroplast and Mitochondria Gene Families	AT3G27690	77.3	9.4e-107	384.4
Sed13g1162	.	5	264	Chloroplast and Mitochondria Gene Families	AT3G27690	67.0	4.0e-97	352.4
Sed10g1659	.	110	313	Chloroplast and Mitochondria Gene Families	AT3G27690	53.1	1.0e-52	204.9
Sed06g0152	.	3	267	Chloroplast and Mitochondria Gene Families	AT3G61470	80.5	4.9e-128	454.9
Sed06g1754	.	3	267	Chloroplast and Mitochondria Gene Families	AT3G61470	80.1	8.3e-128	454.1
Sed12g1695	.	69	274	Chloroplast and Mitochondria Gene Families	AT3G61470	64.1	4.8e-83	305.4
Sed08g2078	.	22	245	Chloroplast and Mitochondria Gene Families	AT3G61470	50.6	2.3e-61	233.4
Sed11g0951	.	43	253	Chloroplast and Mitochondria Gene Families	AT3G61470	50.5	1.6e-54	210.7
Sed01g2838	.	1	200	Chloroplast and Mitochondria Gene Families	AT3G54890	79.5	2.0e-87	319.7
Sed14g0644	.	6	288	Chloroplast and Mitochondria Gene Families	AT3G08940	79.2	1.9e-128	456.4
Sed14g0643	.	6	307	Chloroplast and Mitochondria Gene Families	AT3G08940	73.8	2.8e-124	442.6
Sed01g2387	.	1	330	Chloroplast and Mitochondria Gene Families	AT1G76570	72.8	1.9e-140	496.5
Sed08g1153	.	1	269	Chloroplast and Mitochondria Gene Families	AT1G61520	84.6	7.0e-133	471.1
Sed08g1156	.	1	269	Chloroplast and Mitochondria Gene Families	AT1G61520	84.6	7.0e-133	471.1
Sed05g2091	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G05070	89.4	8.5e-144	507.3
Sed04g3726	.	1	264	Chloroplast and Mitochondria Gene Families	AT2G05070	87.9	4.4e-140	495.0
Sed10g0156	.	5	267	Chloroplast and Mitochondria Gene Families	AT2G05070	78.4	8.6e-120	427.6
Sed01g2226	.	5	265	Chloroplast and Mitochondria Gene Families	AT2G05070	78.9	8.6e-120	427.6
Sed10g0157	.	5	266	Chloroplast and Mitochondria Gene Families	AT2G05070	78.7	1.5e-119	426.8
Sed10g0155	.	5	266	Chloroplast and Mitochondria Gene Families	AT2G05070	78.7	1.9e-119	426.4
Sed14g1562	.	5	268	Chloroplast and Mitochondria Gene Families	AT2G05070	77.3	5.6e-119	424.9
Sed14g1563	.	5	268	Chloroplast and Mitochondria Gene Families	AT2G05070	77.3	5.6e-119	424.9
Sed05g1289	.	189	446	Chloroplast and Mitochondria Gene Families	AT2G05070	79.2	4.7e-118	421.8
Sed06g1212	.	28	247	Chloroplast and Mitochondria Gene Families	AT2G05070	87.7	9.8e-116	414.1
Sed01g0736	.	7	262	Chloroplast and Mitochondria Gene Families	AT2G05070	77.5	8.3e-115	411.0
Sed05g1288	.	22	244	Chloroplast and Mitochondria Gene Families	AT2G05070	79.1	3.7e-107	385.6
Sed13g1162	.	8	264	Chloroplast and Mitochondria Gene Families	AT2G05070	67.7	3.5e-97	352.4
Sed10g1659	.	110	313	Chloroplast and Mitochondria Gene Families	AT2G05070	53.6	6.9e-53	205.3
Sed05g2091	.	1	237	Chloroplast and Mitochondria Gene Families	AT2G05100	89.5	4.8e-125	445.3
Sed04g3726	.	1	236	Chloroplast and Mitochondria Gene Families	AT2G05100	87.8	2.4e-121	433.0
Sed14g1562	.	5	240	Chloroplast and Mitochondria Gene Families	AT2G05100	76.7	6.3e-101	365.2
Sed14g1563	.	5	240	Chloroplast and Mitochondria Gene Families	AT2G05100	76.7	6.3e-101	365.2
Sed10g0156	.	5	239	Chloroplast and Mitochondria Gene Families	AT2G05100	75.8	8.2e-101	364.8
Sed01g2226	.	5	237	Chloroplast and Mitochondria Gene Families	AT2G05100	77.0	8.2e-101	364.8
Sed10g0157	.	5	238	Chloroplast and Mitochondria Gene Families	AT2G05100	76.2	1.4e-100	364.0
Sed10g0155	.	5	238	Chloroplast and Mitochondria Gene Families	AT2G05100	76.2	1.8e-100	363.6
Sed01g0736	.	7	238	Chloroplast and Mitochondria Gene Families	AT2G05100	76.5	2.0e-99	360.1
Sed05g1289	.	208	418	Chloroplast and Mitochondria Gene Families	AT2G05100	82.0	2.6e-99	359.8
Sed06g1212	.	28	219	Chloroplast and Mitochondria Gene Families	AT2G05100	86.5	3.2e-97	352.8
Sed05g1288	.	18	216	Chloroplast and Mitochondria Gene Families	AT2G05100	75.4	9.4e-89	324.7
Sed13g1162	.	8	236	Chloroplast and Mitochondria Gene Families	AT2G05100	67.6	2.9e-82	303.1
Sed10g1659	.	110	297	Chloroplast and Mitochondria Gene Families	AT2G05100	52.3	2.4e-44	177.2
Sed14g0644	.	1	171	Chloroplast and Mitochondria Gene Families	AT2G40100	68.2	2.0e-62	236.5
Sed14g0643	.	1	190	Chloroplast and Mitochondria Gene Families	AT2G40100	61.5	7.7e-59	224.6
Sed14g1562	.	1	268	Chloroplast and Mitochondria Gene Families	AT1G29930	88.1	2.5e-135	479.2
Sed14g1563	.	1	268	Chloroplast and Mitochondria Gene Families	AT1G29930	88.1	2.5e-135	479.2
Sed10g0157	.	1	266	Chloroplast and Mitochondria Gene Families	AT1G29930	87.6	3.3e-135	478.8
Sed10g0155	.	1	266	Chloroplast and Mitochondria Gene Families	AT1G29930	87.3	4.3e-135	478.4
Sed01g2226	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29930	87.6	4.7e-134	474.9
Sed10g0156	.	1	267	Chloroplast and Mitochondria Gene Families	AT1G29930	87.3	8.1e-134	474.2
Sed01g0736	.	1	262	Chloroplast and Mitochondria Gene Families	AT1G29930	88.6	3.4e-132	468.8
Sed05g1289	.	182	446	Chloroplast and Mitochondria Gene Families	AT1G29930	83.3	6.2e-126	448.0
Sed06g1212	.	4	247	Chloroplast and Mitochondria Gene Families	AT1G29930	82.4	3.9e-120	428.7
Sed04g3726	.	3	264	Chloroplast and Mitochondria Gene Families	AT1G29930	78.9	7.6e-116	414.5
Sed05g2091	.	30	265	Chloroplast and Mitochondria Gene Families	AT1G29930	82.9	4.9e-115	411.8
Sed05g1288	.	21	244	Chloroplast and Mitochondria Gene Families	AT1G29930	84.0	4.2e-114	408.7
Sed13g1162	.	22	264	Chloroplast and Mitochondria Gene Families	AT1G29930	69.7	1.1e-93	340.9
Sed14g1562	.	1	268	Chloroplast and Mitochondria Gene Families	AT1G29920	87.7	9.5e-135	477.2
Sed14g1563	.	1	268	Chloroplast and Mitochondria Gene Families	AT1G29920	87.7	9.5e-135	477.2
Sed10g0157	.	1	266	Chloroplast and Mitochondria Gene Families	AT1G29920	87.3	1.2e-134	476.9
Sed10g0155	.	1	266	Chloroplast and Mitochondria Gene Families	AT1G29920	86.9	1.6e-134	476.5
Sed01g2226	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29920	87.3	1.8e-133	473.0
Sed10g0156	.	1	267	Chloroplast and Mitochondria Gene Families	AT1G29920	86.9	3.1e-133	472.2
Sed01g0736	.	1	262	Chloroplast and Mitochondria Gene Families	AT1G29920	88.3	1.3e-131	466.8
Sed05g1289	.	182	446	Chloroplast and Mitochondria Gene Families	AT1G29920	83.3	8.1e-126	447.6
Sed06g1212	.	4	247	Chloroplast and Mitochondria Gene Families	AT1G29920	82.4	5.1e-120	428.3
Sed04g3726	.	32	264	Chloroplast and Mitochondria Gene Families	AT1G29920	84.8	9.9e-116	414.1
Sed05g2091	.	30	265	Chloroplast and Mitochondria Gene Families	AT1G29920	82.9	4.9e-115	411.8
Sed05g1288	.	21	244	Chloroplast and Mitochondria Gene Families	AT1G29920	84.0	4.2e-114	408.7
Sed13g1162	.	22	264	Chloroplast and Mitochondria Gene Families	AT1G29920	69.7	1.1e-93	340.9
Sed14g1562	.	1	268	Chloroplast and Mitochondria Gene Families	AT1G29910	87.7	9.5e-135	477.2
Sed14g1563	.	1	268	Chloroplast and Mitochondria Gene Families	AT1G29910	87.7	9.5e-135	477.2
Sed10g0157	.	1	266	Chloroplast and Mitochondria Gene Families	AT1G29910	87.3	1.2e-134	476.9
Sed10g0155	.	1	266	Chloroplast and Mitochondria Gene Families	AT1G29910	86.9	1.6e-134	476.5
Sed01g2226	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29910	87.3	1.8e-133	473.0
Sed10g0156	.	1	267	Chloroplast and Mitochondria Gene Families	AT1G29910	86.9	3.1e-133	472.2
Sed01g0736	.	1	262	Chloroplast and Mitochondria Gene Families	AT1G29910	88.3	1.3e-131	466.8
Sed05g1289	.	182	446	Chloroplast and Mitochondria Gene Families	AT1G29910	83.3	8.1e-126	447.6
Sed06g1212	.	4	247	Chloroplast and Mitochondria Gene Families	AT1G29910	82.4	5.1e-120	428.3
Sed04g3726	.	32	264	Chloroplast and Mitochondria Gene Families	AT1G29910	84.8	9.9e-116	414.1
Sed05g2091	.	30	265	Chloroplast and Mitochondria Gene Families	AT1G29910	82.9	4.9e-115	411.8
Sed05g1288	.	21	244	Chloroplast and Mitochondria Gene Families	AT1G29910	84.0	4.2e-114	408.7
Sed13g1162	.	22	264	Chloroplast and Mitochondria Gene Families	AT1G29910	69.7	1.1e-93	340.9
Sed10g1659	.	50	328	Chloroplast and Mitochondria Gene Families	AT4G10340	84.6	1.7e-134	476.5
Sed14g1562	.	41	256	Chloroplast and Mitochondria Gene Families	AT4G10340	51.5	3.8e-57	219.5
Sed14g1563	.	41	256	Chloroplast and Mitochondria Gene Families	AT4G10340	51.5	3.8e-57	219.5
Sed10g0155	.	50	254	Chloroplast and Mitochondria Gene Families	AT4G10340	54.1	4.9e-57	219.2
Sed10g0156	.	51	255	Chloroplast and Mitochondria Gene Families	AT4G10340	54.1	4.9e-57	219.2
Sed10g0157	.	50	254	Chloroplast and Mitochondria Gene Families	AT4G10340	54.1	4.9e-57	219.2
Sed01g0736	.	50	254	Chloroplast and Mitochondria Gene Families	AT4G10340	54.1	4.9e-57	219.2
Sed01g2226	.	40	253	Chloroplast and Mitochondria Gene Families	AT4G10340	53.2	1.9e-56	217.2
Sed05g1289	.	230	434	Chloroplast and Mitochondria Gene Families	AT4G10340	53.1	3.2e-56	216.5
Sed06g1212	.	31	235	Chloroplast and Mitochondria Gene Families	AT4G10340	53.1	4.2e-56	216.1
Sed05g2091	.	49	253	Chloroplast and Mitochondria Gene Families	AT4G10340	52.6	1.3e-54	211.1
Sed04g3726	.	48	252	Chloroplast and Mitochondria Gene Families	AT4G10340	51.7	5.6e-53	205.7
Sed13g1162	.	46	252	Chloroplast and Mitochondria Gene Families	AT4G10340	53.1	4.0e-51	199.5
Sed14g1562	.	1	268	Chloroplast and Mitochondria Gene Families	AT2G34420	87.0	1.5e-132	469.9
Sed14g1563	.	1	268	Chloroplast and Mitochondria Gene Families	AT2G34420	87.0	1.5e-132	469.9
Sed10g0157	.	1	266	Chloroplast and Mitochondria Gene Families	AT2G34420	86.5	2.0e-132	469.5
Sed10g0155	.	1	266	Chloroplast and Mitochondria Gene Families	AT2G34420	86.1	2.6e-132	469.2
Sed01g2226	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G34420	86.5	2.2e-131	466.1
Sed10g0156	.	1	267	Chloroplast and Mitochondria Gene Families	AT2G34420	86.2	4.9e-131	464.9
Sed01g0736	.	1	262	Chloroplast and Mitochondria Gene Families	AT2G34420	88.3	3.2e-130	462.2
Sed05g1289	.	188	446	Chloroplast and Mitochondria Gene Families	AT2G34420	84.7	3.1e-125	445.7
Sed06g1212	.	29	247	Chloroplast and Mitochondria Gene Families	AT2G34420	92.7	3.5e-121	432.2
Sed04g3726	.	32	264	Chloroplast and Mitochondria Gene Families	AT2G34420	84.4	2.2e-115	412.9
Sed05g2091	.	3	265	Chloroplast and Mitochondria Gene Families	AT2G34420	77.5	2.2e-115	412.9
Sed05g1288	.	21	244	Chloroplast and Mitochondria Gene Families	AT2G34420	84.0	5.4e-114	408.3
Sed13g1162	.	22	264	Chloroplast and Mitochondria Gene Families	AT2G34420	70.1	1.1e-93	340.9
Sed10g1659	.	110	313	Chloroplast and Mitochondria Gene Families	AT2G34420	52.4	1.8e-53	207.2
Sed01g2226	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G34430	87.2	1.2e-134	476.9
Sed14g1562	.	1	268	Chloroplast and Mitochondria Gene Families	AT2G34430	88.1	6.2e-134	474.6
Sed14g1563	.	1	268	Chloroplast and Mitochondria Gene Families	AT2G34430	88.1	6.2e-134	474.6
Sed10g0157	.	1	266	Chloroplast and Mitochondria Gene Families	AT2G34430	87.6	8.0e-134	474.2
Sed10g0155	.	1	266	Chloroplast and Mitochondria Gene Families	AT2G34430	87.3	1.1e-133	473.8
Sed10g0156	.	1	267	Chloroplast and Mitochondria Gene Families	AT2G34430	86.9	2.3e-133	472.6
Sed01g0736	.	1	262	Chloroplast and Mitochondria Gene Families	AT2G34430	87.9	5.4e-130	461.5
Sed05g1289	.	182	446	Chloroplast and Mitochondria Gene Families	AT2G34430	83.3	5.6e-127	451.4
Sed06g1212	.	29	247	Chloroplast and Mitochondria Gene Families	AT2G34430	92.7	4.6e-121	431.8
Sed05g1288	.	22	244	Chloroplast and Mitochondria Gene Families	AT2G34430	84.3	2.9e-115	412.5
Sed04g3726	.	32	264	Chloroplast and Mitochondria Gene Families	AT2G34430	84.3	1.9e-114	409.8
Sed05g2091	.	31	265	Chloroplast and Mitochondria Gene Families	AT2G34430	82.8	2.1e-113	406.4
Sed13g1162	.	34	264	Chloroplast and Mitochondria Gene Families	AT2G34430	70.5	1.1e-93	340.9
Sed14g0644	.	3	288	Chloroplast and Mitochondria Gene Families	AT5G01530	81.1	5.7e-133	471.5
Sed14g0643	.	3	307	Chloroplast and Mitochondria Gene Families	AT5G01530	76.1	1.0e-129	460.7
Sed07g1803	.	48	307	Chloroplast and Mitochondria Gene Families	AT5G40810	94.2	4.9e-144	508.1
Sed13g1065	.	48	307	Chloroplast and Mitochondria Gene Families	AT5G40810	93.8	1.4e-143	506.5
Sed13g1067	.	48	307	Chloroplast and Mitochondria Gene Families	AT5G40810	93.8	1.4e-143	506.5
Sed13g1066	.	48	307	Chloroplast and Mitochondria Gene Families	AT5G40810	93.8	1.4e-143	506.5
Sed07g1803	.	1	307	Chloroplast and Mitochondria Gene Families	AT3G27240	85.8	2.1e-149	526.2
Sed13g1065	.	1	307	Chloroplast and Mitochondria Gene Families	AT3G27240	84.2	6.6e-148	521.2
Sed13g1067	.	1	307	Chloroplast and Mitochondria Gene Families	AT3G27240	84.2	6.6e-148	521.2
Sed13g1066	.	1	307	Chloroplast and Mitochondria Gene Families	AT3G27240	84.2	6.6e-148	521.2
Sed05g3793	.	5	323	Chloroplast and Mitochondria Gene Families	AT2G30160	74.4	1.5e-137	486.9
Sed03g2513	.	81	360	Chloroplast and Mitochondria Gene Families	AT2G30160	63.3	2.2e-101	366.7
Sed05g3793	.	5	329	Chloroplast and Mitochondria Gene Families	AT1G07030	75.0	2.4e-140	496.1
Sed03g2513	.	60	360	Chloroplast and Mitochondria Gene Families	AT1G07030	61.0	1.9e-105	380.2
Sed07g0557	.	1	301	Chloroplast and Mitochondria Gene Families	AT2G47490	76.4	1.5e-131	466.8
Sed03g1162	.	11	313	Chloroplast and Mitochondria Gene Families	AT2G47490	61.4	1.1e-105	380.9
Sed07g0813	.	1	297	Chloroplast and Mitochondria Gene Families	AT2G47490	62.8	6.0e-96	348.6
Sed03g1162	.	10	362	Chloroplast and Mitochondria Gene Families	AT1G25380	63.8	1.3e-121	434.1
Sed07g0557	.	12	293	Chloroplast and Mitochondria Gene Families	AT1G25380	65.3	4.3e-106	382.5
Sed07g0813	.	12	289	Chloroplast and Mitochondria Gene Families	AT1G25380	53.5	7.5e-74	275.4
Sed01g2055	.	7	584	Chloroplast and Mitochondria Gene Families	AT4G21490	75.0	3.3e-257	885.2
Sed01g2056	.	7	584	Chloroplast and Mitochondria Gene Families	AT4G21490	75.0	3.3e-257	885.2
Sed08g2309	.	7	573	Chloroplast and Mitochondria Gene Families	AT4G21490	73.0	4.3e-249	858.2
Sed05g3116	.	5	584	Chloroplast and Mitochondria Gene Families	AT4G21490	69.6	4.0e-239	825.1
Sed05g1975	.	4	574	Chloroplast and Mitochondria Gene Families	AT4G21490	65.2	1.8e-226	783.1
Sed09g1672	.	3	182	Chloroplast and Mitochondria Gene Families	AT1G17530	65.6	7.4e-62	234.6
Sed04g0795	.	5	186	Chloroplast and Mitochondria Gene Families	AT1G17530	63.8	2.6e-59	226.1
Sed06g0682	.	1	179	Chloroplast and Mitochondria Gene Families	AT1G17530	56.9	1.3e-50	197.2
Sed06g0682	.	1	183	Chloroplast and Mitochondria Gene Families	AT3G04800	56.5	4.6e-51	198.7
Sed04g0795	.	22	186	Chloroplast and Mitochondria Gene Families	AT3G04800	56.3	2.5e-41	166.4
Sed09g1672	.	18	184	Chloroplast and Mitochondria Gene Families	AT3G04800	54.4	7.4e-41	164.9
Sed09g1672	.	2	184	Chloroplast and Mitochondria Gene Families	AT1G72750	66.8	7.6e-62	234.6
Sed04g0795	.	15	186	Chloroplast and Mitochondria Gene Families	AT1G72750	67.2	2.1e-59	226.5
Sed06g0682	.	3	183	Chloroplast and Mitochondria Gene Families	AT1G72750	57.1	1.2e-51	200.7
Sed06g1856	.	4	217	Chloroplast and Mitochondria Gene Families	AT1G26100	58.9	4.4e-67	252.3
Sed06g1857	.	7	182	Chloroplast and Mitochondria Gene Families	AT1G26100	65.3	1.9e-65	246.9
Sed03g0307	.	1	226	Chloroplast and Mitochondria Gene Families	AT5G38630	69.2	8.9e-89	324.3
Sed11g2091	.	1	224	Chloroplast and Mitochondria Gene Families	AT5G38630	68.0	4.6e-85	312.0
Sed01g3590	.	23	218	Chloroplast and Mitochondria Gene Families	AT4G25570	69.9	9.2e-80	294.7
Sed03g0981	.	6	356	Chloroplast and Mitochondria Gene Families	AT5G14040	81.6	2.0e-170	596.3
Sed11g1566	.	7	356	Chloroplast and Mitochondria Gene Families	AT5G14040	82.4	1.7e-169	593.2
Sed08g1540	.	5	354	Chloroplast and Mitochondria Gene Families	AT5G14040	73.3	3.3e-149	525.8
Sed05g2146	.	11	298	Chloroplast and Mitochondria Gene Families	AT5G14040	52.4	2.0e-85	313.9
Sed05g2147	.	11	298	Chloroplast and Mitochondria Gene Families	AT5G14040	52.4	2.0e-85	313.9
Sed03g0982	.	15	283	Chloroplast and Mitochondria Gene Families	AT5G14040	52.6	8.0e-71	265.4
Sed11g1566	.	8	356	Chloroplast and Mitochondria Gene Families	AT3G48850	71.2	5.2e-144	508.4
Sed03g0981	.	8	356	Chloroplast and Mitochondria Gene Families	AT3G48850	69.2	2.4e-141	499.6
Sed08g1540	.	8	361	Chloroplast and Mitochondria Gene Families	AT3G48850	69.7	3.2e-141	499.2
Sed05g2146	.	11	297	Chloroplast and Mitochondria Gene Families	AT3G48850	51.5	1.1e-85	314.7
Sed05g2147	.	11	297	Chloroplast and Mitochondria Gene Families	AT3G48850	51.5	1.1e-85	314.7
Sed05g2146	.	14	307	Chloroplast and Mitochondria Gene Families	AT2G17270	75.5	6.7e-132	468.0
Sed05g2147	.	14	307	Chloroplast and Mitochondria Gene Families	AT2G17270	75.5	6.7e-132	468.0
Sed08g1540	.	57	352	Chloroplast and Mitochondria Gene Families	AT2G17270	52.4	8.6e-87	318.2
Sed11g1566	.	62	353	Chloroplast and Mitochondria Gene Families	AT2G17270	52.4	2.8e-85	313.2
Sed03g0981	.	56	347	Chloroplast and Mitochondria Gene Families	AT2G17270	52.1	3.6e-85	312.8
Sed11g2055	.	16	319	Chloroplast and Mitochondria Gene Families	AT5G15640	75.6	4.4e-131	465.3
Sed13g1891	.	12	346	Chloroplast and Mitochondria Gene Families	AT5G26200	67.5	3.3e-124	442.6
Sed09g1667	.	1	347	Chloroplast and Mitochondria Gene Families	AT5G26200	59.0	5.7e-108	388.7
Sed09g1667	.	1	352	Chloroplast and Mitochondria Gene Families	AT1G72820	74.4	7.0e-146	514.6
Sed13g1891	.	1	347	Chloroplast and Mitochondria Gene Families	AT1G72820	68.4	2.8e-126	449.5
Sed01g3857	.	79	284	Chloroplast and Mitochondria Gene Families	AT5G52570	51.0	8.3e-50	194.9
Sed13g0115	.	1	217	Chloroplast and Mitochondria Gene Families	AT4G25700	64.8	3.7e-71	265.8
Sed07g0989	.	1	225	Chloroplast and Mitochondria Gene Families	AT4G25700	60.9	1.0e-65	247.7
Sed07g0991	.	1	225	Chloroplast and Mitochondria Gene Families	AT4G25700	60.9	1.0e-65	247.7
Sed07g0988	.	1	221	Chloroplast and Mitochondria Gene Families	AT4G25700	61.1	8.7e-65	244.6
Sed07g0990	.	1	221	Chloroplast and Mitochondria Gene Families	AT4G25700	61.1	8.7e-65	244.6
Sed01g3857	.	40	200	Chloroplast and Mitochondria Gene Families	AT4G25700	60.9	6.9e-54	208.4
Sed07g1878	.	96	358	Chloroplast and Mitochondria Gene Families	AT5G54290	85.2	2.0e-119	426.8
Sed08g0534	.	65	552	Chloroplast and Mitochondria Gene Families	AT2G18710	85.2	1.8e-236	816.2

Syn-Orthogroups

Select	Orthogroup	Bda	Bhi	Blo	Bma	Bpe	Cam	Car	Cco	Cec	Chy	Cla	Clacu	Cma	Cme	Cmetu	Cmo	Cmu	Cone	Cpe	Cre	Csa	HCH	Hepe	Lac	Lcy	Lsi	Mch	Sed	Tan	Vvi	Total
	OG0001994	2	2	3	3	2	2	3	2	2	2	2	2	3	2	2	3	2	2	3	2	2	2	2	2	2	2	2	3	2	1	66