Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Sed09g0151 ATGAAGACCGGAATGCCATACCACGGCGGCGCCGGCGAGGATCTTCATTTCCTCGAATCCTGCTTCCTCTGCCGGAGACCGCTCGGATTCAACCGAGACATCTTCATGTACAAAGGAAACACGGCGTTCTGTAGCAAGGATTGCAGGCAAGAACAGATCGAGTTCGACGAAGCGCAGGAGAAGAGCTGGCGGATCTCTTCGTCACCGGCGGCGAAATCGACGGCGTCGAGTAAGAAGAATGTGCGGACAGATACAGTTGCCGTAGCGTGA 270 55.56 MKTGMPYHGGAGEDLHFLESCFLCRRPLGFNRDIFMYKGNTAFCSKDCRQEQIEFDEAQEKSWRISSSPAAKSTASSKKNVRTDTVAVA 89
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
9 1163286 1164418 + Sed0002491.1 Sed09g0151 724915

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Sed09g0151 89 MobiDBLite consensus disorder prediction 62 83 - -
Sed09g0151 89 PANTHER FCS-LIKE ZINC FINGER 1-RELATED 13 89 IPR044533 -
Sed09g0151 89 Pfam zinc-finger of the FCS-type, C2-C2 12 58 IPR007650 -
Sed09g0151 89 ProSiteProfiles Zinc finger FLZ-type profile. 16 60 IPR007650 -
Sed09g0151 89 MobiDBLite consensus disorder prediction 59 89 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Sed09g0151 - - - - 0.0
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Sed09g0151 Sed-Chr9:1163286 Sed13g0954 Sed-Chr13:7341647 1.30E-11 dispersed
Sed12g0323 Sed-Chr12:2021026 Sed09g0151 Sed-Chr9:1163286 1.10E-17 wgd
Sed02g1540 Sed-Chr2:51093922 Sed09g0151 Sed-Chr9:1163286 5.10E-22 wgd
Sed04g2119 Sed-Chr4:35377202 Sed09g0151 Sed-Chr9:1163286 4.20E-32 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi5g1317 . . . . . . . . Cmo08g00192 . . . . . . . . . . . . . . . Cla06g00101 Cam06g0114 Cec06g0113 Cco06g0112 Clacu06g0114 Cmu06g0112 Cre06g0882 . . . . . . . . . . . . . . . . Sed09g0151 . . . . Car08g00170 . . Cpe17g01080 Bhi12g02474 Tan06g2240 Cmetu05g1545 Lac12g1976 . . Lcy13g0854 . . . . . . . . . . Cme11g02437
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002002 3 1 0 2 1 2 4 2 2 1 2 2 4 2 2 4 2 1 4 2 2 2 2 2 2 2 2 4 3 0 64