Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Sed14g1562 ATGGCTGCCTCAACAATGGCTCTCTCTTCCCCATCTCTGGCTGGCCAGGCCATCAAGCTCTCCCCCAATGCCTCTGAGGTTCAGGGCAATGGAAGAGTCAGCATGAGGAAGACCGCCGGCAGGAAGCCAGCTCCCTCCAGCTCCGGCAGCCCGTGGTACGGCCCCGACCGTGTCAAGTACTTGGGACCATTCTCTGGCGAGGCACCATCATACCTCACCGGTGAATTCCCTGGCGACTATGGCTGGGACACTGCTGGACTTTCCGCTGACCCCGAGACCTTCGCCAAGAACCGTGAGCTCGAAGTGATCCACTCCAGATGGGCCATGCTTGGAGCTCTTGGCTGTGTCTTCCCCGAGCTTCTGTCCCGCAATGGCGTGAAATTCGGCGAGGCCGTGTGGTTCAAGGCTGGATCACAGATCTTCAGCGAGGGAGGATTGGACTACTTGGGAAACTCCAGCTTGGTCCATGCACAGAGCATTTTGGCCATCTGGGCCTGCCAGGTTGTGTTGATGGGTGCCGTTGAGGGCTACCGTATTGCCGGCGGTCCGCTCGGGGAGATCACCGACCCCATCTACCCCGGTGGAAGCTTTGACCCGTTGGGTTTGGCTGATGATCCAGAGGCCTTTGCTGAGTTGAAGGTGAAGGAGCTCAAGAATGGAAGACTGGCCATGTTCTCCATGTTTGGATTCTTTGTTCAGGCCATTGTTACCGGAAAGGGACCATTGGAGAACTTGGCTGACCACCTTGCAGACCCAGTGAACAACAATGCTTGGGCCTTTGCCACCAACTTTGTCCCTGGAAAGTGA 807 57.25 MAASTMALSSPSLAGQAIKLSPNASEVQGNGRVSMRKTAGRKPAPSSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNSSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 268
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
14 23798355 23799675 - Sed0001377.1 Sed14g1562 737280

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Sed14g1562 268 FunFam Chlorophyll a-b binding protein, chloroplastic 59 261 - -
Sed14g1562 268 MobiDBLite consensus disorder prediction 18 51 - -
Sed14g1562 268 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 4 268 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0009941(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Sed14g1562 268 MobiDBLite consensus disorder prediction 18 32 - -
Sed14g1562 268 Pfam Chlorophyll A-B binding protein 68 235 IPR022796 -
Sed14g1562 268 SUPERFAMILY Chlorophyll a-b binding protein 51 265 - -
Sed14g1562 268 Gene3D Chlorophyll a/b binding protein domain 59 261 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Sed14g1562 K08912 - - csv:101213845 517.694
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Sed01g2387 Sed-Chr1:17929741 Sed14g1562 Sed-Chr14:23798355 5.10E-53 dispersed
Sed04g3726 Sed-Chr4:46021408 Sed14g1562 Sed-Chr14:23798355 2.50E-119 dispersed
Sed05g2091 Sed-Chr5:34076276 Sed14g1562 Sed-Chr14:23798355 2.80E-118 dispersed
Sed10g0156 Sed-Chr10:961812 Sed14g1562 Sed-Chr14:23798355 8.00E-150 dispersed
Sed10g0157 Sed-Chr10:965751 Sed14g1562 Sed-Chr14:23798355 7.50E-148 dispersed
Sed10g1659 Sed-Chr10:33259814 Sed14g1562 Sed-Chr14:23798355 1.60E-59 dispersed
Sed13g1162 Sed-Chr13:14698087 Sed14g1562 Sed-Chr14:23798355 9.50E-95 dispersed
Sed14g1562 Sed-Chr14:23798355 Sed14g1563 Sed-Chr14:23801374 1.40E-154 tandem
Sed10g0155 Sed-Chr10:959200 Sed14g1562 Sed-Chr14:23798355 5.70E-148 wgd
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Sed13g1378 . 1 441 Chloroplast and Mitochondria Gene Families AT2G28800 61.8 1.2e-134 477.6
Sed04g0012 . 71 408 Chloroplast and Mitochondria Gene Families AT2G28800 56.1 6.8e-98 355.5
Sed04g0013 . 1 295 Chloroplast and Mitochondria Gene Families AT2G28800 57.3 1.4e-87 321.2
Sed10g1833 . 3 256 Chloroplast and Mitochondria Gene Families AT1G15820 79.2 8.7e-117 417.5
Sed10g1832 . 3 256 Chloroplast and Mitochondria Gene Families AT1G15820 79.2 1.9e-116 416.4
Sed05g2091 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 89.1 6.2e-143 504.6
Sed04g3726 . 1 264 Chloroplast and Mitochondria Gene Families AT3G27690 87.2 4.9e-140 495.0
Sed10g0156 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 76.5 4.3e-120 428.7
Sed10g0157 . 2 266 Chloroplast and Mitochondria Gene Families AT3G27690 76.8 7.4e-120 427.9
Sed10g0155 . 2 266 Chloroplast and Mitochondria Gene Families AT3G27690 76.8 9.7e-120 427.6
Sed14g1562 . 2 268 Chloroplast and Mitochondria Gene Families AT3G27690 76.1 1.6e-119 426.8
Sed14g1563 . 2 268 Chloroplast and Mitochondria Gene Families AT3G27690 76.1 1.6e-119 426.8
Sed01g2226 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 1.4e-118 423.7
Sed05g1289 . 179 446 Chloroplast and Mitochondria Gene Families AT3G27690 74.5 2.6e-117 419.5
Sed01g0736 . 2 262 Chloroplast and Mitochondria Gene Families AT3G27690 76.4 5.0e-116 415.2
Sed06g1212 . 28 247 Chloroplast and Mitochondria Gene Families AT3G27690 86.8 2.5e-115 412.9
Sed05g1288 . 19 244 Chloroplast and Mitochondria Gene Families AT3G27690 77.3 9.4e-107 384.4
Sed13g1162 . 5 264 Chloroplast and Mitochondria Gene Families AT3G27690 67.0 4.0e-97 352.4
Sed10g1659 . 110 313 Chloroplast and Mitochondria Gene Families AT3G27690 53.1 1.0e-52 204.9
Sed06g0152 . 3 267 Chloroplast and Mitochondria Gene Families AT3G61470 80.5 4.9e-128 454.9
Sed06g1754 . 3 267 Chloroplast and Mitochondria Gene Families AT3G61470 80.1 8.3e-128 454.1
Sed12g1695 . 69 274 Chloroplast and Mitochondria Gene Families AT3G61470 64.1 4.8e-83 305.4
Sed08g2078 . 22 245 Chloroplast and Mitochondria Gene Families AT3G61470 50.6 2.3e-61 233.4
Sed11g0951 . 43 253 Chloroplast and Mitochondria Gene Families AT3G61470 50.5 1.6e-54 210.7
Sed01g2838 . 1 200 Chloroplast and Mitochondria Gene Families AT3G54890 79.5 2.0e-87 319.7
Sed14g0644 . 6 288 Chloroplast and Mitochondria Gene Families AT3G08940 79.2 1.9e-128 456.4
Sed14g0643 . 6 307 Chloroplast and Mitochondria Gene Families AT3G08940 73.8 2.8e-124 442.6
Sed01g2387 . 1 330 Chloroplast and Mitochondria Gene Families AT1G76570 72.8 1.9e-140 496.5
Sed08g1153 . 1 269 Chloroplast and Mitochondria Gene Families AT1G61520 84.6 7.0e-133 471.1
Sed08g1156 . 1 269 Chloroplast and Mitochondria Gene Families AT1G61520 84.6 7.0e-133 471.1
Sed05g2091 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.4 8.5e-144 507.3
Sed04g3726 . 1 264 Chloroplast and Mitochondria Gene Families AT2G05070 87.9 4.4e-140 495.0
Sed10g0156 . 5 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.4 8.6e-120 427.6
Sed01g2226 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 8.6e-120 427.6
Sed10g0157 . 5 266 Chloroplast and Mitochondria Gene Families AT2G05070 78.7 1.5e-119 426.8
Sed10g0155 . 5 266 Chloroplast and Mitochondria Gene Families AT2G05070 78.7 1.9e-119 426.4
Sed14g1562 . 5 268 Chloroplast and Mitochondria Gene Families AT2G05070 77.3 5.6e-119 424.9
Sed14g1563 . 5 268 Chloroplast and Mitochondria Gene Families AT2G05070 77.3 5.6e-119 424.9
Sed05g1289 . 189 446 Chloroplast and Mitochondria Gene Families AT2G05070 79.2 4.7e-118 421.8
Sed06g1212 . 28 247 Chloroplast and Mitochondria Gene Families AT2G05070 87.7 9.8e-116 414.1
Sed01g0736 . 7 262 Chloroplast and Mitochondria Gene Families AT2G05070 77.5 8.3e-115 411.0
Sed05g1288 . 22 244 Chloroplast and Mitochondria Gene Families AT2G05070 79.1 3.7e-107 385.6
Sed13g1162 . 8 264 Chloroplast and Mitochondria Gene Families AT2G05070 67.7 3.5e-97 352.4
Sed10g1659 . 110 313 Chloroplast and Mitochondria Gene Families AT2G05070 53.6 6.9e-53 205.3
Sed05g2091 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.5 4.8e-125 445.3
Sed04g3726 . 1 236 Chloroplast and Mitochondria Gene Families AT2G05100 87.8 2.4e-121 433.0
Sed14g1562 . 5 240 Chloroplast and Mitochondria Gene Families AT2G05100 76.7 6.3e-101 365.2
Sed14g1563 . 5 240 Chloroplast and Mitochondria Gene Families AT2G05100 76.7 6.3e-101 365.2
Sed10g0156 . 5 239 Chloroplast and Mitochondria Gene Families AT2G05100 75.8 8.2e-101 364.8
Sed01g2226 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.0 8.2e-101 364.8
Sed10g0157 . 5 238 Chloroplast and Mitochondria Gene Families AT2G05100 76.2 1.4e-100 364.0
Sed10g0155 . 5 238 Chloroplast and Mitochondria Gene Families AT2G05100 76.2 1.8e-100 363.6
Sed01g0736 . 7 238 Chloroplast and Mitochondria Gene Families AT2G05100 76.5 2.0e-99 360.1
Sed05g1289 . 208 418 Chloroplast and Mitochondria Gene Families AT2G05100 82.0 2.6e-99 359.8
Sed06g1212 . 28 219 Chloroplast and Mitochondria Gene Families AT2G05100 86.5 3.2e-97 352.8
Sed05g1288 . 18 216 Chloroplast and Mitochondria Gene Families AT2G05100 75.4 9.4e-89 324.7
Sed13g1162 . 8 236 Chloroplast and Mitochondria Gene Families AT2G05100 67.6 2.9e-82 303.1
Sed10g1659 . 110 297 Chloroplast and Mitochondria Gene Families AT2G05100 52.3 2.4e-44 177.2
Sed14g0644 . 1 171 Chloroplast and Mitochondria Gene Families AT2G40100 68.2 2.0e-62 236.5
Sed14g0643 . 1 190 Chloroplast and Mitochondria Gene Families AT2G40100 61.5 7.7e-59 224.6
Sed14g1562 . 1 268 Chloroplast and Mitochondria Gene Families AT1G29930 88.1 2.5e-135 479.2
Sed14g1563 . 1 268 Chloroplast and Mitochondria Gene Families AT1G29930 88.1 2.5e-135 479.2
Sed10g0157 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 87.6 3.3e-135 478.8
Sed10g0155 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 87.3 4.3e-135 478.4
Sed01g2226 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 87.6 4.7e-134 474.9
Sed10g0156 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 87.3 8.1e-134 474.2
Sed01g0736 . 1 262 Chloroplast and Mitochondria Gene Families AT1G29930 88.6 3.4e-132 468.8
Sed05g1289 . 182 446 Chloroplast and Mitochondria Gene Families AT1G29930 83.3 6.2e-126 448.0
Sed06g1212 . 4 247 Chloroplast and Mitochondria Gene Families AT1G29930 82.4 3.9e-120 428.7
Sed04g3726 . 3 264 Chloroplast and Mitochondria Gene Families AT1G29930 78.9 7.6e-116 414.5
Sed05g2091 . 30 265 Chloroplast and Mitochondria Gene Families AT1G29930 82.9 4.9e-115 411.8
Sed05g1288 . 21 244 Chloroplast and Mitochondria Gene Families AT1G29930 84.0 4.2e-114 408.7
Sed13g1162 . 22 264 Chloroplast and Mitochondria Gene Families AT1G29930 69.7 1.1e-93 340.9
Sed14g1562 . 1 268 Chloroplast and Mitochondria Gene Families AT1G29920 87.7 9.5e-135 477.2
Sed14g1563 . 1 268 Chloroplast and Mitochondria Gene Families AT1G29920 87.7 9.5e-135 477.2
Sed10g0157 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 87.3 1.2e-134 476.9
Sed10g0155 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 86.9 1.6e-134 476.5
Sed01g2226 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.3 1.8e-133 473.0
Sed10g0156 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 86.9 3.1e-133 472.2
Sed01g0736 . 1 262 Chloroplast and Mitochondria Gene Families AT1G29920 88.3 1.3e-131 466.8
Sed05g1289 . 182 446 Chloroplast and Mitochondria Gene Families AT1G29920 83.3 8.1e-126 447.6
Sed06g1212 . 4 247 Chloroplast and Mitochondria Gene Families AT1G29920 82.4 5.1e-120 428.3
Sed04g3726 . 32 264 Chloroplast and Mitochondria Gene Families AT1G29920 84.8 9.9e-116 414.1
Sed05g2091 . 30 265 Chloroplast and Mitochondria Gene Families AT1G29920 82.9 4.9e-115 411.8
Sed05g1288 . 21 244 Chloroplast and Mitochondria Gene Families AT1G29920 84.0 4.2e-114 408.7
Sed13g1162 . 22 264 Chloroplast and Mitochondria Gene Families AT1G29920 69.7 1.1e-93 340.9
Sed14g1562 . 1 268 Chloroplast and Mitochondria Gene Families AT1G29910 87.7 9.5e-135 477.2
Sed14g1563 . 1 268 Chloroplast and Mitochondria Gene Families AT1G29910 87.7 9.5e-135 477.2
Sed10g0157 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 87.3 1.2e-134 476.9
Sed10g0155 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 86.9 1.6e-134 476.5
Sed01g2226 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.3 1.8e-133 473.0
Sed10g0156 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 86.9 3.1e-133 472.2
Sed01g0736 . 1 262 Chloroplast and Mitochondria Gene Families AT1G29910 88.3 1.3e-131 466.8
Sed05g1289 . 182 446 Chloroplast and Mitochondria Gene Families AT1G29910 83.3 8.1e-126 447.6
Sed06g1212 . 4 247 Chloroplast and Mitochondria Gene Families AT1G29910 82.4 5.1e-120 428.3
Sed04g3726 . 32 264 Chloroplast and Mitochondria Gene Families AT1G29910 84.8 9.9e-116 414.1
Sed05g2091 . 30 265 Chloroplast and Mitochondria Gene Families AT1G29910 82.9 4.9e-115 411.8
Sed05g1288 . 21 244 Chloroplast and Mitochondria Gene Families AT1G29910 84.0 4.2e-114 408.7
Sed13g1162 . 22 264 Chloroplast and Mitochondria Gene Families AT1G29910 69.7 1.1e-93 340.9
Sed10g1659 . 50 328 Chloroplast and Mitochondria Gene Families AT4G10340 84.6 1.7e-134 476.5
Sed14g1562 . 41 256 Chloroplast and Mitochondria Gene Families AT4G10340 51.5 3.8e-57 219.5
Sed14g1563 . 41 256 Chloroplast and Mitochondria Gene Families AT4G10340 51.5 3.8e-57 219.5
Sed10g0155 . 50 254 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 4.9e-57 219.2
Sed10g0156 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 4.9e-57 219.2
Sed10g0157 . 50 254 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 4.9e-57 219.2
Sed01g0736 . 50 254 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 4.9e-57 219.2
Sed01g2226 . 40 253 Chloroplast and Mitochondria Gene Families AT4G10340 53.2 1.9e-56 217.2
Sed05g1289 . 230 434 Chloroplast and Mitochondria Gene Families AT4G10340 53.1 3.2e-56 216.5
Sed06g1212 . 31 235 Chloroplast and Mitochondria Gene Families AT4G10340 53.1 4.2e-56 216.1
Sed05g2091 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 1.3e-54 211.1
Sed04g3726 . 48 252 Chloroplast and Mitochondria Gene Families AT4G10340 51.7 5.6e-53 205.7
Sed13g1162 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 53.1 4.0e-51 199.5
Sed14g1562 . 1 268 Chloroplast and Mitochondria Gene Families AT2G34420 87.0 1.5e-132 469.9
Sed14g1563 . 1 268 Chloroplast and Mitochondria Gene Families AT2G34420 87.0 1.5e-132 469.9
Sed10g0157 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34420 86.5 2.0e-132 469.5
Sed10g0155 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34420 86.1 2.6e-132 469.2
Sed01g2226 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 86.5 2.2e-131 466.1
Sed10g0156 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 86.2 4.9e-131 464.9
Sed01g0736 . 1 262 Chloroplast and Mitochondria Gene Families AT2G34420 88.3 3.2e-130 462.2
Sed05g1289 . 188 446 Chloroplast and Mitochondria Gene Families AT2G34420 84.7 3.1e-125 445.7
Sed06g1212 . 29 247 Chloroplast and Mitochondria Gene Families AT2G34420 92.7 3.5e-121 432.2
Sed04g3726 . 32 264 Chloroplast and Mitochondria Gene Families AT2G34420 84.4 2.2e-115 412.9
Sed05g2091 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 77.5 2.2e-115 412.9
Sed05g1288 . 21 244 Chloroplast and Mitochondria Gene Families AT2G34420 84.0 5.4e-114 408.3
Sed13g1162 . 22 264 Chloroplast and Mitochondria Gene Families AT2G34420 70.1 1.1e-93 340.9
Sed10g1659 . 110 313 Chloroplast and Mitochondria Gene Families AT2G34420 52.4 1.8e-53 207.2
Sed01g2226 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.2 1.2e-134 476.9
Sed14g1562 . 1 268 Chloroplast and Mitochondria Gene Families AT2G34430 88.1 6.2e-134 474.6
Sed14g1563 . 1 268 Chloroplast and Mitochondria Gene Families AT2G34430 88.1 6.2e-134 474.6
Sed10g0157 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 8.0e-134 474.2
Sed10g0155 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34430 87.3 1.1e-133 473.8
Sed10g0156 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 86.9 2.3e-133 472.6
Sed01g0736 . 1 262 Chloroplast and Mitochondria Gene Families AT2G34430 87.9 5.4e-130 461.5
Sed05g1289 . 182 446 Chloroplast and Mitochondria Gene Families AT2G34430 83.3 5.6e-127 451.4
Sed06g1212 . 29 247 Chloroplast and Mitochondria Gene Families AT2G34430 92.7 4.6e-121 431.8
Sed05g1288 . 22 244 Chloroplast and Mitochondria Gene Families AT2G34430 84.3 2.9e-115 412.5
Sed04g3726 . 32 264 Chloroplast and Mitochondria Gene Families AT2G34430 84.3 1.9e-114 409.8
Sed05g2091 . 31 265 Chloroplast and Mitochondria Gene Families AT2G34430 82.8 2.1e-113 406.4
Sed13g1162 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34430 70.5 1.1e-93 340.9
Sed14g0644 . 3 288 Chloroplast and Mitochondria Gene Families AT5G01530 81.1 5.7e-133 471.5
Sed14g0643 . 3 307 Chloroplast and Mitochondria Gene Families AT5G01530 76.1 1.0e-129 460.7
Sed07g1803 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 94.2 4.9e-144 508.1
Sed13g1065 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.8 1.4e-143 506.5
Sed13g1067 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.8 1.4e-143 506.5
Sed13g1066 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.8 1.4e-143 506.5
Sed07g1803 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 85.8 2.1e-149 526.2
Sed13g1065 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 84.2 6.6e-148 521.2
Sed13g1067 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 84.2 6.6e-148 521.2
Sed13g1066 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 84.2 6.6e-148 521.2
Sed05g3793 . 5 323 Chloroplast and Mitochondria Gene Families AT2G30160 74.4 1.5e-137 486.9
Sed03g2513 . 81 360 Chloroplast and Mitochondria Gene Families AT2G30160 63.3 2.2e-101 366.7
Sed05g3793 . 5 329 Chloroplast and Mitochondria Gene Families AT1G07030 75.0 2.4e-140 496.1
Sed03g2513 . 60 360 Chloroplast and Mitochondria Gene Families AT1G07030 61.0 1.9e-105 380.2
Sed07g0557 . 1 301 Chloroplast and Mitochondria Gene Families AT2G47490 76.4 1.5e-131 466.8
Sed03g1162 . 11 313 Chloroplast and Mitochondria Gene Families AT2G47490 61.4 1.1e-105 380.9
Sed07g0813 . 1 297 Chloroplast and Mitochondria Gene Families AT2G47490 62.8 6.0e-96 348.6
Sed03g1162 . 10 362 Chloroplast and Mitochondria Gene Families AT1G25380 63.8 1.3e-121 434.1
Sed07g0557 . 12 293 Chloroplast and Mitochondria Gene Families AT1G25380 65.3 4.3e-106 382.5
Sed07g0813 . 12 289 Chloroplast and Mitochondria Gene Families AT1G25380 53.5 7.5e-74 275.4
Sed01g2055 . 7 584 Chloroplast and Mitochondria Gene Families AT4G21490 75.0 3.3e-257 885.2
Sed01g2056 . 7 584 Chloroplast and Mitochondria Gene Families AT4G21490 75.0 3.3e-257 885.2
Sed08g2309 . 7 573 Chloroplast and Mitochondria Gene Families AT4G21490 73.0 4.3e-249 858.2
Sed05g3116 . 5 584 Chloroplast and Mitochondria Gene Families AT4G21490 69.6 4.0e-239 825.1
Sed05g1975 . 4 574 Chloroplast and Mitochondria Gene Families AT4G21490 65.2 1.8e-226 783.1
Sed09g1672 . 3 182 Chloroplast and Mitochondria Gene Families AT1G17530 65.6 7.4e-62 234.6
Sed04g0795 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 63.8 2.6e-59 226.1
Sed06g0682 . 1 179 Chloroplast and Mitochondria Gene Families AT1G17530 56.9 1.3e-50 197.2
Sed06g0682 . 1 183 Chloroplast and Mitochondria Gene Families AT3G04800 56.5 4.6e-51 198.7
Sed04g0795 . 22 186 Chloroplast and Mitochondria Gene Families AT3G04800 56.3 2.5e-41 166.4
Sed09g1672 . 18 184 Chloroplast and Mitochondria Gene Families AT3G04800 54.4 7.4e-41 164.9
Sed09g1672 . 2 184 Chloroplast and Mitochondria Gene Families AT1G72750 66.8 7.6e-62 234.6
Sed04g0795 . 15 186 Chloroplast and Mitochondria Gene Families AT1G72750 67.2 2.1e-59 226.5
Sed06g0682 . 3 183 Chloroplast and Mitochondria Gene Families AT1G72750 57.1 1.2e-51 200.7
Sed06g1856 . 4 217 Chloroplast and Mitochondria Gene Families AT1G26100 58.9 4.4e-67 252.3
Sed06g1857 . 7 182 Chloroplast and Mitochondria Gene Families AT1G26100 65.3 1.9e-65 246.9
Sed03g0307 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 69.2 8.9e-89 324.3
Sed11g2091 . 1 224 Chloroplast and Mitochondria Gene Families AT5G38630 68.0 4.6e-85 312.0
Sed01g3590 . 23 218 Chloroplast and Mitochondria Gene Families AT4G25570 69.9 9.2e-80 294.7
Sed03g0981 . 6 356 Chloroplast and Mitochondria Gene Families AT5G14040 81.6 2.0e-170 596.3
Sed11g1566 . 7 356 Chloroplast and Mitochondria Gene Families AT5G14040 82.4 1.7e-169 593.2
Sed08g1540 . 5 354 Chloroplast and Mitochondria Gene Families AT5G14040 73.3 3.3e-149 525.8
Sed05g2146 . 11 298 Chloroplast and Mitochondria Gene Families AT5G14040 52.4 2.0e-85 313.9
Sed05g2147 . 11 298 Chloroplast and Mitochondria Gene Families AT5G14040 52.4 2.0e-85 313.9
Sed03g0982 . 15 283 Chloroplast and Mitochondria Gene Families AT5G14040 52.6 8.0e-71 265.4
Sed11g1566 . 8 356 Chloroplast and Mitochondria Gene Families AT3G48850 71.2 5.2e-144 508.4
Sed03g0981 . 8 356 Chloroplast and Mitochondria Gene Families AT3G48850 69.2 2.4e-141 499.6
Sed08g1540 . 8 361 Chloroplast and Mitochondria Gene Families AT3G48850 69.7 3.2e-141 499.2
Sed05g2146 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 51.5 1.1e-85 314.7
Sed05g2147 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 51.5 1.1e-85 314.7
Sed05g2146 . 14 307 Chloroplast and Mitochondria Gene Families AT2G17270 75.5 6.7e-132 468.0
Sed05g2147 . 14 307 Chloroplast and Mitochondria Gene Families AT2G17270 75.5 6.7e-132 468.0
Sed08g1540 . 57 352 Chloroplast and Mitochondria Gene Families AT2G17270 52.4 8.6e-87 318.2
Sed11g1566 . 62 353 Chloroplast and Mitochondria Gene Families AT2G17270 52.4 2.8e-85 313.2
Sed03g0981 . 56 347 Chloroplast and Mitochondria Gene Families AT2G17270 52.1 3.6e-85 312.8
Sed11g2055 . 16 319 Chloroplast and Mitochondria Gene Families AT5G15640 75.6 4.4e-131 465.3
Sed13g1891 . 12 346 Chloroplast and Mitochondria Gene Families AT5G26200 67.5 3.3e-124 442.6
Sed09g1667 . 1 347 Chloroplast and Mitochondria Gene Families AT5G26200 59.0 5.7e-108 388.7
Sed09g1667 . 1 352 Chloroplast and Mitochondria Gene Families AT1G72820 74.4 7.0e-146 514.6
Sed13g1891 . 1 347 Chloroplast and Mitochondria Gene Families AT1G72820 68.4 2.8e-126 449.5
Sed01g3857 . 79 284 Chloroplast and Mitochondria Gene Families AT5G52570 51.0 8.3e-50 194.9
Sed13g0115 . 1 217 Chloroplast and Mitochondria Gene Families AT4G25700 64.8 3.7e-71 265.8
Sed07g0989 . 1 225 Chloroplast and Mitochondria Gene Families AT4G25700 60.9 1.0e-65 247.7
Sed07g0991 . 1 225 Chloroplast and Mitochondria Gene Families AT4G25700 60.9 1.0e-65 247.7
Sed07g0988 . 1 221 Chloroplast and Mitochondria Gene Families AT4G25700 61.1 8.7e-65 244.6
Sed07g0990 . 1 221 Chloroplast and Mitochondria Gene Families AT4G25700 61.1 8.7e-65 244.6
Sed01g3857 . 40 200 Chloroplast and Mitochondria Gene Families AT4G25700 60.9 6.9e-54 208.4
Sed07g1878 . 96 358 Chloroplast and Mitochondria Gene Families AT5G54290 85.2 2.0e-119 426.8
Sed08g0534 . 65 552 Chloroplast and Mitochondria Gene Families AT2G18710 85.2 1.8e-236 816.2