Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Tan08g0631 ATGGTGGAGTTAGCTAAAGCTCATGCAAAGGCTTTAATGCCTTCATTTGGAGATGGTAAAGAAGATCAACGATTAATTGAGTCTCTCACACAAGACATAACTAATTTAATCAAGAAATCAGAGAAGGGACTCAAGAGACTCTCTGTAGCTGGACCTTCGGAAGATTCCAATATCAGAAAAAATGTCCAGCGATCTCTTGCCACTGACCTTCAGAACCTTTCCATGGAGCTTCGCAAGAAACAATCAACTTATTTAAAGCGCCTACGGCAGCAAAAAGAGGAAGTTCAAGATGGGATTGACATAGAGATGAATCGAAATGGAAATAGATCAAGACTGGAGGACGATGATTTAGAAGACATGGTATTTAATGAGCATCAAATGGCTAAGCTGCGAAAGAGTGAAGCATTCACTGCCGAAAGAGAGAAAGAGATCCAACATGTTGTAGAATCCGTGAATGAACTTGCTCAGATCATGAAGGATCTATCAGTTCTTGTTATAGACCAGGGCACCATTATTGATAGAATAGATTATAATATTCAAAATGTTGCAACGACGGTCGATGAGGGCCTTAAGCAACTGCAGAAGGCGGAGAGAACACAGAAACAAGGAGGGATGGTAATGTGTGCGTCTGTGCTCATTATCATGTGCTTCGTCATGTTGGTTCTCTTGATCCTTAAAACCATACTATTTTGA 693 40.55 MVELAKAHAKALMPSFGDGKEDQRLIESLTQDITNLIKKSEKGLKRLSVAGPSEDSNIRKNVQRSLATDLQNLSMELRKKQSTYLKRLRQQKEEVQDGIDIEMNRNGNRSRLEDDDLEDMVFNEHQMAKLRKSEAFTAEREKEIQHVVESVNELAQIMKDLSVLVIDQGTIIDRIDYNIQNVATTVDEGLKQLQKAERTQKQGGMVMCASVLIIMCFVMLVLLILKTILF 230
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
8 6385332 6390099 + Tan0021761.2 Tan08g0631 760523

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Tan08g0631 230 ProSitePatterns Syntaxin / epimorphin family signature. 140 179 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Tan08g0631 230 Pfam SNARE domain 170 222 IPR000727 -
Tan08g0631 230 Gene3D - 1 188 - -
Tan08g0631 230 SUPERFAMILY t-snare proteins 3 189 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Tan08g0631 230 Coils Coil 85 105 - -
Tan08g0631 230 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 134 196 IPR000727 -
Tan08g0631 230 FunFam Syntaxin-43 1 188 - -
Tan08g0631 230 CDD SNARE_syntaxin16 138 195 - -
Tan08g0631 230 PANTHER SYNTAXIN 15 214 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0006886(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Tan08g0631 230 SMART tSNARE_6 129 196 IPR000727 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Tan08g0631 K08489 - - csv:101207998 416.772
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Tan08g0631 Tan-Chr8:6385332 Tan08g0633 Tan-Chr8:6385332 5.20E-111 dispersed
Tan08g0630 Tan-Chr8:6385332 Tan08g0631 Tan-Chr8:6385332 9.20E-116 tandem
Tan08g0631 Tan-Chr8:6385332 Tan08g0632 Tan-Chr8:6385332 1.30E-109 tandem
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi14g133 . . . . . . . . . . Cma05g01087 Cma12g01045 Car05g00958 Car12g01004 . Cpe07g00878 Cpe11g00890 . . . . . . . Cla02g01497 Cam02g1577 Cec02g1601 Cco02g1642 Clacu02g1560 Cmu02g1513 Cre02g1836 Cone10ag0804 Cone3ag0826 . . . Csa02g00478 . Cme05g01576 . . Bda01g01638 . . . . Bma05g00265 Sed11g0396 Cmo05g01102 Cmo12g01056 . . . . . . Bhi06g01461 Tan08g0631 Cmetu05g1168 . Hepe08g2281 . . . . . . . . . Lsi11g00612 . Chy05g01060 .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Tan02g2666 . 8 337 SNARE and Associated Proteins AT3G24350 62.6 1.1e-102 370.9
Tan03g0640 . 1 308 SNARE and Associated Proteins AT1G08560 71.2 3.4e-105 379.0
Tan03g1990 . 375 673 SNARE and Associated Proteins AT2G18260 56.5 3.1e-87 319.3
Tan08g1616 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 2.2e-115 412.9
Tan03g1265 . 21 280 SNARE and Associated Proteins AT3G11820 70.4 3.7e-99 359.0
Tan05g3221 . 26 281 SNARE and Associated Proteins AT3G11820 65.6 3.0e-93 339.3
Tan10g1572 . 27 285 SNARE and Associated Proteins AT3G11820 52.1 1.7e-67 253.8
Tan08g1616 . 1 279 SNARE and Associated Proteins AT3G52400 63.9 1.4e-91 334.0
Tan03g1265 . 1 275 SNARE and Associated Proteins AT3G52400 59.8 2.1e-84 310.1
Tan05g3221 . 1 281 SNARE and Associated Proteins AT3G52400 56.5 6.4e-81 298.5
Tan05g3221 . 1 299 SNARE and Associated Proteins AT4G03330 69.9 2.5e-108 389.4
Tan08g1616 . 1 280 SNARE and Associated Proteins AT4G03330 58.0 2.7e-83 306.2
Tan03g1265 . 1 278 SNARE and Associated Proteins AT4G03330 52.3 6.8e-74 275.0
Tan10g1572 . 1 285 SNARE and Associated Proteins AT4G03330 51.2 9.5e-68 254.6
Tan05g3221 . 1 303 SNARE and Associated Proteins AT1G61290 78.5 5.3e-127 451.4
Tan08g1616 . 1 280 SNARE and Associated Proteins AT1G61290 62.4 4.6e-91 332.0
Tan03g1265 . 1 275 SNARE and Associated Proteins AT1G61290 56.4 6.3e-80 295.0
Tan05g3221 . 1 303 SNARE and Associated Proteins AT1G11250 77.9 1.1e-124 443.7
Tan08g1616 . 1 280 SNARE and Associated Proteins AT1G11250 62.9 1.7e-93 340.1
Tan03g1265 . 1 275 SNARE and Associated Proteins AT1G11250 56.7 1.7e-82 303.5
Tan10g1572 . 1 308 SNARE and Associated Proteins AT3G03800 73.1 3.9e-114 408.7
Tan05g0864 . 78 348 SNARE and Associated Proteins AT3G03800 58.3 2.3e-82 303.1
Tan10g1572 . 1 203 SNARE and Associated Proteins AT5G08080 76.4 1.9e-78 289.7
Tan05g0864 . 47 247 SNARE and Associated Proteins AT5G08080 59.7 6.3e-53 204.9
Tan01g2212 . 1 256 SNARE and Associated Proteins AT5G16830 59.9 6.6e-76 281.6
Tan01g2212 . 1 256 SNARE and Associated Proteins AT5G46860 66.8 6.6e-81 298.1
Tan01g2212 . 1 256 SNARE and Associated Proteins AT4G17730 61.3 1.3e-73 273.9
Tan01g2212 . 65 256 SNARE and Associated Proteins AT1G32270 60.9 1.3e-52 204.5
Tan04g0181 . 1 334 SNARE and Associated Proteins AT5G05760 65.7 1.4e-112 403.7
Tan02g2666 . 8 337 SNARE and Associated Proteins AT3G24350 62.6 1.1e-102 370.9
Tan06g0761 . 1 319 SNARE and Associated Proteins AT5G26980 66.8 1.9e-103 373.2
Tan06g0762 . 1 328 SNARE and Associated Proteins AT5G26980 65.0 1.6e-102 370.2
Tan08g0631 . 1 228 SNARE and Associated Proteins AT5G26980 78.1 2.1e-86 316.6
Tan08g0630 . 1 228 SNARE and Associated Proteins AT5G26980 78.1 2.1e-86 316.6
Tan08g0633 . 1 258 SNARE and Associated Proteins AT5G26980 69.0 1.2e-81 300.8
Tan08g0632 . 1 270 SNARE and Associated Proteins AT5G26980 65.9 3.0e-80 296.2
Tan08g0634 . 1 300 SNARE and Associated Proteins AT5G26980 59.3 1.7e-75 280.4
Tan06g0761 . 1 319 SNARE and Associated Proteins AT4G02195 67.2 1.6e-105 380.2
Tan06g0762 . 1 328 SNARE and Associated Proteins AT4G02195 65.4 3.3e-103 372.5
Tan08g0631 . 1 230 SNARE and Associated Proteins AT4G02195 68.0 9.1e-77 284.6
Tan08g0630 . 1 230 SNARE and Associated Proteins AT4G02195 68.0 9.1e-77 284.6
Tan08g0633 . 1 260 SNARE and Associated Proteins AT4G02195 60.2 5.1e-72 268.9
Tan08g0632 . 1 272 SNARE and Associated Proteins AT4G02195 57.5 1.3e-70 264.2
Tan08g0634 . 1 302 SNARE and Associated Proteins AT4G02195 51.8 7.2e-66 248.4
Tan06g0761 . 1 319 SNARE and Associated Proteins AT3G05710 63.4 4.3e-98 355.5
Tan06g0762 . 1 328 SNARE and Associated Proteins AT3G05710 61.7 4.7e-97 352.1
Tan08g0631 . 1 229 SNARE and Associated Proteins AT3G05710 80.3 1.3e-91 334.0
Tan08g0630 . 1 229 SNARE and Associated Proteins AT3G05710 80.3 1.3e-91 334.0
Tan08g0633 . 1 259 SNARE and Associated Proteins AT3G05710 71.0 7.6e-87 318.2
Tan08g0632 . 1 271 SNARE and Associated Proteins AT3G05710 67.9 1.9e-85 313.5
Tan08g0634 . 1 301 SNARE and Associated Proteins AT3G05710 61.1 1.1e-80 297.7
Tan01g3132 . 1 233 SNARE and Associated Proteins AT1G16240 71.7 2.0e-89 326.2
Tan01g1776 . 4 232 SNARE and Associated Proteins AT1G16240 67.7 1.5e-81 300.1
Tan01g1777 . 4 232 SNARE and Associated Proteins AT1G16240 67.7 1.5e-81 300.1
Tan01g3132 . 1 233 SNARE and Associated Proteins AT1G79590 71.2 1.9e-88 323.2
Tan01g1776 . 4 232 SNARE and Associated Proteins AT1G79590 68.1 7.7e-82 301.2
Tan01g1777 . 4 232 SNARE and Associated Proteins AT1G79590 68.1 7.7e-82 301.2
Tan09g0537 . 56 246 SNARE and Associated Proteins AT1G28490 70.7 1.7e-65 246.5
Tan11g2093 . 56 246 SNARE and Associated Proteins AT1G28490 70.2 1.9e-64 243.0
Tan11g2090 . 56 246 SNARE and Associated Proteins AT1G28490 70.2 1.9e-64 243.0
Tan11g2091 . 56 192 SNARE and Associated Proteins AT1G28490 66.4 3.4e-42 169.1
Tan11g2092 . 56 192 SNARE and Associated Proteins AT1G28490 66.4 3.4e-42 169.1
Tan08g1893 . 1 264 SNARE and Associated Proteins AT3G09740 79.7 8.5e-113 404.1
Tan05g0265 . 1 265 SNARE and Associated Proteins AT3G09740 68.3 9.4e-96 347.4
Tan05g0265 . 1 265 SNARE and Associated Proteins AT3G45280 65.7 8.5e-89 324.3
Tan08g1893 . 1 264 SNARE and Associated Proteins AT3G45280 64.4 1.2e-87 320.5
Tan08g1893 . 1 261 SNARE and Associated Proteins AT3G61450 68.6 2.1e-95 346.3
Tan05g0265 . 1 262 SNARE and Associated Proteins AT3G61450 60.8 3.0e-86 315.8
Tan11g0243 . 65 310 SNARE and Associated Proteins AT1G51740 74.1 2.6e-92 335.9
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0003497 3 1 2 2 1 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 1 1 1 4 4 2 46