Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Tan08g1616 ATGAACGATTTGTTCTCCTCTCGCTCTTTCTCTCGCGACAGCCATGTCGTTGAGATGGGTAACTCCTCCTCTTCCCCTACTGCTGTTAATCTCGACAAGTTCTTTGATGATGTTGAATCTGTTAAAGACGAGCTCAAGGAGCTTGAGCGACTCTACCAGAACCTCCATGACTCCCATGAACAGAGCAAGACCCTTCACAATGCTAAGGCTGTTAAGGACCTCCGATCTCGCATGGATTCCGATGTTGCTCTTGCTCTCAAGAAGGCTAAGCTCATTAAGGTCCGATTGGAGGCCCTTGATCGCTCCAATGCCGCCAATCGGAGCCTCCCTGGTTGCGGCCCCGGATCTTCCTCTGACCGGACTCGGACTTCTGTGGTCAACGGCTTGAGGAAAAAATTGCAGGATTCCATGGAGAGCTTCAATAATCTCAGGCAGCAGATCTCCTCTGAGTACAGGGAGACCGTGCAGCGAAGGTATTTCACTGTTACTGGTGAAAATCCGGACGAGAAGACCATTGATATCTTGATTTCTACAGGTGAAAGTGAGACATTCTTGCAGAAAGCCATTCAAGAACAAGGTAGAGGCAGAATCTTAGACACCATTAGCGAGATCCAGGAGAGGCATGATGCTGTAAAAGACCTGGAAAGGAATCTCAAGGAGCTGCACCAGGTTTTCTTGGACATGGCAGTCTTGGTGCACGAGCAAGGTGAGAAACTCGACGACATCGAGAGCCAAGTGAACAGGGCTCATTCTTTTGTCCGAGGCGGCACACAGGAGTTGACAACAGCCAGAGTATACCAGAAAAACACCCGGAAATGGACAATCATTGCCATCATCATTTTGCTGATCGTTGTCCTCGCGGTTATCCTCAGCCTGAAGCCTTGGAATTGGAATAATGGTAGTAATAGTAGTGGTTCAACCCCGTCAAACCCTTCAACCCCTTAA 945 48.89 MNDLFSSRSFSRDSHVVEMGNSSSSPTAVNLDKFFDDVESVKDELKELERLYQNLHDSHEQSKTLHNAKAVKDLRSRMDSDVALALKKAKLIKVRLEALDRSNAANRSLPGCGPGSSSDRTRTSVVNGLRKKLQDSMESFNNLRQQISSEYRETVQRRYFTVTGENPDEKTIDILISTGESETFLQKAIQEQGRGRILDTISEIQERHDAVKDLERNLKELHQVFLDMAVLVHEQGEKLDDIESQVNRAHSFVRGGTQELTTARVYQKNTRKWTIIAIIILLIVVLAVILSLKPWNWNNGSNSSGSTPSNPSTP 314
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
8 65581678 65584495 - Tan0004634.1 Tan08g1616 761508

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Tan08g1616 314 Gene3D - 197 293 - -
Tan08g1616 314 Pfam Syntaxin 33 236 IPR006011 GO:0016020(InterPro)
Tan08g1616 314 FunFam Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group 28 158 - -
Tan08g1616 314 FunFam Syntaxin 132 194 293 - -
Tan08g1616 314 CDD SNARE_syntaxin1-like 200 262 - -
Tan08g1616 314 ProSitePatterns Syntaxin / epimorphin family signature. 207 246 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Tan08g1616 314 SMART tSNARE_6 196 263 IPR000727 -
Tan08g1616 314 Pfam SNARE domain 237 289 IPR000727 -
Tan08g1616 314 CDD SynN 31 188 IPR006011 GO:0016020(InterPro)
Tan08g1616 314 Gene3D - 29 161 - -
Tan08g1616 314 Coils Coil 204 224 - -
Tan08g1616 314 Coils Coil 126 150 - -
Tan08g1616 314 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 201 263 IPR000727 -
Tan08g1616 314 SUPERFAMILY t-snare proteins 30 256 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Tan08g1616 314 Coils Coil 31 65 - -
Tan08g1616 314 PANTHER SYNTAXIN 33 280 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0005886(PANTHER)|GO:0006886(PANTHER)|GO:0006887(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Tan08g1616 314 SMART SynN_4 26 152 IPR006011 GO:0016020(InterPro)
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Tan08g1616 K08486 - - csv:101208931 508.834
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Tan03g0640 Tan-Chr3:61653655 Tan08g1616 Tan-Chr8:65581678 3.50E-62 transposed
Tan03g1990 Tan-Chr3:74930080 Tan08g1616 Tan-Chr8:65581678 8.30E-48 transposed
Tan05g3221 Tan-Chr5:84265978 Tan08g1616 Tan-Chr8:65581678 1.30E-90 transposed
Tan10g1572 Tan-Chr10:25325195 Tan08g1616 Tan-Chr8:65581678 1.50E-65 transposed
Tan03g1265 Tan-Chr3:68938151 Tan08g1616 Tan-Chr8:65581678 2.60E-110 wgd
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Tan02g2666 . 8 337 SNARE and Associated Proteins AT3G24350 62.6 1.1e-102 370.9
Tan03g0640 . 1 308 SNARE and Associated Proteins AT1G08560 71.2 3.4e-105 379.0
Tan03g1990 . 375 673 SNARE and Associated Proteins AT2G18260 56.5 3.1e-87 319.3
Tan08g1616 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 2.2e-115 412.9
Tan03g1265 . 21 280 SNARE and Associated Proteins AT3G11820 70.4 3.7e-99 359.0
Tan05g3221 . 26 281 SNARE and Associated Proteins AT3G11820 65.6 3.0e-93 339.3
Tan10g1572 . 27 285 SNARE and Associated Proteins AT3G11820 52.1 1.7e-67 253.8
Tan08g1616 . 1 279 SNARE and Associated Proteins AT3G52400 63.9 1.4e-91 334.0
Tan03g1265 . 1 275 SNARE and Associated Proteins AT3G52400 59.8 2.1e-84 310.1
Tan05g3221 . 1 281 SNARE and Associated Proteins AT3G52400 56.5 6.4e-81 298.5
Tan05g3221 . 1 299 SNARE and Associated Proteins AT4G03330 69.9 2.5e-108 389.4
Tan08g1616 . 1 280 SNARE and Associated Proteins AT4G03330 58.0 2.7e-83 306.2
Tan03g1265 . 1 278 SNARE and Associated Proteins AT4G03330 52.3 6.8e-74 275.0
Tan10g1572 . 1 285 SNARE and Associated Proteins AT4G03330 51.2 9.5e-68 254.6
Tan05g3221 . 1 303 SNARE and Associated Proteins AT1G61290 78.5 5.3e-127 451.4
Tan08g1616 . 1 280 SNARE and Associated Proteins AT1G61290 62.4 4.6e-91 332.0
Tan03g1265 . 1 275 SNARE and Associated Proteins AT1G61290 56.4 6.3e-80 295.0
Tan05g3221 . 1 303 SNARE and Associated Proteins AT1G11250 77.9 1.1e-124 443.7
Tan08g1616 . 1 280 SNARE and Associated Proteins AT1G11250 62.9 1.7e-93 340.1
Tan03g1265 . 1 275 SNARE and Associated Proteins AT1G11250 56.7 1.7e-82 303.5
Tan10g1572 . 1 308 SNARE and Associated Proteins AT3G03800 73.1 3.9e-114 408.7
Tan05g0864 . 78 348 SNARE and Associated Proteins AT3G03800 58.3 2.3e-82 303.1
Tan10g1572 . 1 203 SNARE and Associated Proteins AT5G08080 76.4 1.9e-78 289.7
Tan05g0864 . 47 247 SNARE and Associated Proteins AT5G08080 59.7 6.3e-53 204.9
Tan01g2212 . 1 256 SNARE and Associated Proteins AT5G16830 59.9 6.6e-76 281.6
Tan01g2212 . 1 256 SNARE and Associated Proteins AT5G46860 66.8 6.6e-81 298.1
Tan01g2212 . 1 256 SNARE and Associated Proteins AT4G17730 61.3 1.3e-73 273.9
Tan01g2212 . 65 256 SNARE and Associated Proteins AT1G32270 60.9 1.3e-52 204.5
Tan04g0181 . 1 334 SNARE and Associated Proteins AT5G05760 65.7 1.4e-112 403.7
Tan02g2666 . 8 337 SNARE and Associated Proteins AT3G24350 62.6 1.1e-102 370.9
Tan06g0761 . 1 319 SNARE and Associated Proteins AT5G26980 66.8 1.9e-103 373.2
Tan06g0762 . 1 328 SNARE and Associated Proteins AT5G26980 65.0 1.6e-102 370.2
Tan08g0631 . 1 228 SNARE and Associated Proteins AT5G26980 78.1 2.1e-86 316.6
Tan08g0630 . 1 228 SNARE and Associated Proteins AT5G26980 78.1 2.1e-86 316.6
Tan08g0633 . 1 258 SNARE and Associated Proteins AT5G26980 69.0 1.2e-81 300.8
Tan08g0632 . 1 270 SNARE and Associated Proteins AT5G26980 65.9 3.0e-80 296.2
Tan08g0634 . 1 300 SNARE and Associated Proteins AT5G26980 59.3 1.7e-75 280.4
Tan06g0761 . 1 319 SNARE and Associated Proteins AT4G02195 67.2 1.6e-105 380.2
Tan06g0762 . 1 328 SNARE and Associated Proteins AT4G02195 65.4 3.3e-103 372.5
Tan08g0631 . 1 230 SNARE and Associated Proteins AT4G02195 68.0 9.1e-77 284.6
Tan08g0630 . 1 230 SNARE and Associated Proteins AT4G02195 68.0 9.1e-77 284.6
Tan08g0633 . 1 260 SNARE and Associated Proteins AT4G02195 60.2 5.1e-72 268.9
Tan08g0632 . 1 272 SNARE and Associated Proteins AT4G02195 57.5 1.3e-70 264.2
Tan08g0634 . 1 302 SNARE and Associated Proteins AT4G02195 51.8 7.2e-66 248.4
Tan06g0761 . 1 319 SNARE and Associated Proteins AT3G05710 63.4 4.3e-98 355.5
Tan06g0762 . 1 328 SNARE and Associated Proteins AT3G05710 61.7 4.7e-97 352.1
Tan08g0631 . 1 229 SNARE and Associated Proteins AT3G05710 80.3 1.3e-91 334.0
Tan08g0630 . 1 229 SNARE and Associated Proteins AT3G05710 80.3 1.3e-91 334.0
Tan08g0633 . 1 259 SNARE and Associated Proteins AT3G05710 71.0 7.6e-87 318.2
Tan08g0632 . 1 271 SNARE and Associated Proteins AT3G05710 67.9 1.9e-85 313.5
Tan08g0634 . 1 301 SNARE and Associated Proteins AT3G05710 61.1 1.1e-80 297.7
Tan01g3132 . 1 233 SNARE and Associated Proteins AT1G16240 71.7 2.0e-89 326.2
Tan01g1776 . 4 232 SNARE and Associated Proteins AT1G16240 67.7 1.5e-81 300.1
Tan01g1777 . 4 232 SNARE and Associated Proteins AT1G16240 67.7 1.5e-81 300.1
Tan01g3132 . 1 233 SNARE and Associated Proteins AT1G79590 71.2 1.9e-88 323.2
Tan01g1776 . 4 232 SNARE and Associated Proteins AT1G79590 68.1 7.7e-82 301.2
Tan01g1777 . 4 232 SNARE and Associated Proteins AT1G79590 68.1 7.7e-82 301.2
Tan09g0537 . 56 246 SNARE and Associated Proteins AT1G28490 70.7 1.7e-65 246.5
Tan11g2093 . 56 246 SNARE and Associated Proteins AT1G28490 70.2 1.9e-64 243.0
Tan11g2090 . 56 246 SNARE and Associated Proteins AT1G28490 70.2 1.9e-64 243.0
Tan11g2091 . 56 192 SNARE and Associated Proteins AT1G28490 66.4 3.4e-42 169.1
Tan11g2092 . 56 192 SNARE and Associated Proteins AT1G28490 66.4 3.4e-42 169.1
Tan08g1893 . 1 264 SNARE and Associated Proteins AT3G09740 79.7 8.5e-113 404.1
Tan05g0265 . 1 265 SNARE and Associated Proteins AT3G09740 68.3 9.4e-96 347.4
Tan05g0265 . 1 265 SNARE and Associated Proteins AT3G45280 65.7 8.5e-89 324.3
Tan08g1893 . 1 264 SNARE and Associated Proteins AT3G45280 64.4 1.2e-87 320.5
Tan08g1893 . 1 261 SNARE and Associated Proteins AT3G61450 68.6 2.1e-95 346.3
Tan05g0265 . 1 262 SNARE and Associated Proteins AT3G61450 60.8 3.0e-86 315.8
Tan11g0243 . 65 310 SNARE and Associated Proteins AT1G51740 74.1 2.6e-92 335.9
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002313 5 3 2 3 3 1 2 1 1 2 1 2 2 2 2 2 2 2 3 1 3 2 2 2 3 1 2 3 2 0 62