Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Tan10g1572 ATGAACGATCTTCTTTCGGATTCATTTGAGATCCCACGGGGTCAACATTCTAGAGGAGGAGACATTGAACTAGGAACAAATGCTCCTACTAGTGCAGGGGATCTGGGCTTGGAGGATTTCTTTAAAAAGGTCCAAGAGATTGAAAAACAGAATGAGAAGCTGGATAGGTTACTGAGAAAGCTCCAGGATTCACATGAGGAGTCCAAAGCTGTTACCAAAGCTCCAGCAATGAAAGCAATCAAGCAGCGGATGGAAAAGGATGTCGATGAAGTTGGAAAAGTTGCACGCTCTGTGAAGACCAAAGTCGAAGAACTCGACAGAGAGAATCTGGCAAATAGGCAGAGGCTCGGGTGTGGAAAAGGATCAGGTGTAGATAGATCAAGAACAGCAACTACTCTTGCCTTAAAAAAGAAGTTGAAAGACAAGATGACTGAATTCCAGATTCTGCGTGAAAAAATTCATCAAGAGTATCGGGAAGTTGTTGAGAGACGGATTTTCACAGTCACGGGTGCTAGGGCTGACGAGGAGACCATCGAGAAATTAATTGAAACTGGGGATAGTGAACAAATCTTTCAGAAGGCAATTCAAGAACAAGGGCGAGGACGGGTAATGGGTACTCTAGCTGAAATTCAAGAGCGCCACAGTGCAGTTAGAGAACTAGAGAGGAAGTTACTCGAGCTACAGCAGGTATTTCTGGACATGGCGGTATTGGTAGATGCACAAGGGGATATGCTCGATAATATCGAATCACATGTTACAAGTGCAGTAGATCATGTGCAACAGGGGAATACTGCTCTTCAAAAGGCAAAGAAGCTGCAAAAGAATTCTAGGAAATGGATGTGCATTGCCATCATAATCCTTCTAATCATTGTTGTGGTCATAGTAGTGGGAGTCCTTAAGCCATGGAATAATGGTAAGGGTGCCTAA 927 43.8 MNDLLSDSFEIPRGQHSRGGDIELGTNAPTSAGDLGLEDFFKKVQEIEKQNEKLDRLLRKLQDSHEESKAVTKAPAMKAIKQRMEKDVDEVGKVARSVKTKVEELDRENLANRQRLGCGKGSGVDRSRTATTLALKKKLKDKMTEFQILREKIHQEYREVVERRIFTVTGARADEETIEKLIETGDSEQIFQKAIQEQGRGRVMGTLAEIQERHSAVRELERKLLELQQVFLDMAVLVDAQGDMLDNIESHVTSAVDHVQQGNTALQKAKKLQKNSRKWMCIAIIILLIIVVVIVVGVLKPWNNGKGA 308
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
10 25325195 25382614 + Tan0007235.1 Tan10g1572 766366

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Tan10g1572 308 CDD SNARE_syntaxin1-like 206 268 - -
Tan10g1572 308 Gene3D - 203 300 - -
Tan10g1572 308 PANTHER SYNTAXIN 39 289 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0005886(PANTHER)|GO:0006886(PANTHER)|GO:0006887(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Tan10g1572 308 ProSitePatterns Syntaxin / epimorphin family signature. 213 252 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Tan10g1572 308 SUPERFAMILY t-snare proteins 35 262 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Tan10g1572 308 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 207 269 IPR000727 -
Tan10g1572 308 CDD SynN 37 194 IPR006011 GO:0016020(InterPro)
Tan10g1572 308 SMART tSNARE_6 202 269 IPR000727 -
Tan10g1572 308 MobiDBLite consensus disorder prediction 1 29 - -
Tan10g1572 308 Coils Coil 210 230 - -
Tan10g1572 308 Coils Coil 37 71 - -
Tan10g1572 308 Gene3D - 34 161 - -
Tan10g1572 308 FunFam Syntaxin 132 32 161 - -
Tan10g1572 308 FunFam Syntaxin 132 200 300 - -
Tan10g1572 308 Pfam SNARE domain 243 295 IPR000727 -
Tan10g1572 308 Pfam Syntaxin 39 242 IPR006011 GO:0016020(InterPro)
Tan10g1572 308 SMART SynN_4 32 158 IPR006011 GO:0016020(InterPro)
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Tan10g1572 K08486 - - csv:101203075 523.087
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Tan05g0863 Tan-Chr5:6777016 Tan10g1572 Tan-Chr10:25325195 1.30E-14 dispersed
Tan05g0864 Tan-Chr5:6787038 Tan10g1572 Tan-Chr10:25325195 8.80E-86 dispersed
Tan05g3221 Tan-Chr5:84265978 Tan10g1572 Tan-Chr10:25325195 3.30E-65 dispersed
Tan10g1572 Tan-Chr10:25325195 Tan08g1616 Tan-Chr8:65581678 1.50E-65 transposed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Tan02g2666 . 8 337 SNARE and Associated Proteins AT3G24350 62.6 1.1e-102 370.9
Tan03g0640 . 1 308 SNARE and Associated Proteins AT1G08560 71.2 3.4e-105 379.0
Tan03g1990 . 375 673 SNARE and Associated Proteins AT2G18260 56.5 3.1e-87 319.3
Tan08g1616 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 2.2e-115 412.9
Tan03g1265 . 21 280 SNARE and Associated Proteins AT3G11820 70.4 3.7e-99 359.0
Tan05g3221 . 26 281 SNARE and Associated Proteins AT3G11820 65.6 3.0e-93 339.3
Tan10g1572 . 27 285 SNARE and Associated Proteins AT3G11820 52.1 1.7e-67 253.8
Tan08g1616 . 1 279 SNARE and Associated Proteins AT3G52400 63.9 1.4e-91 334.0
Tan03g1265 . 1 275 SNARE and Associated Proteins AT3G52400 59.8 2.1e-84 310.1
Tan05g3221 . 1 281 SNARE and Associated Proteins AT3G52400 56.5 6.4e-81 298.5
Tan05g3221 . 1 299 SNARE and Associated Proteins AT4G03330 69.9 2.5e-108 389.4
Tan08g1616 . 1 280 SNARE and Associated Proteins AT4G03330 58.0 2.7e-83 306.2
Tan03g1265 . 1 278 SNARE and Associated Proteins AT4G03330 52.3 6.8e-74 275.0
Tan10g1572 . 1 285 SNARE and Associated Proteins AT4G03330 51.2 9.5e-68 254.6
Tan05g3221 . 1 303 SNARE and Associated Proteins AT1G61290 78.5 5.3e-127 451.4
Tan08g1616 . 1 280 SNARE and Associated Proteins AT1G61290 62.4 4.6e-91 332.0
Tan03g1265 . 1 275 SNARE and Associated Proteins AT1G61290 56.4 6.3e-80 295.0
Tan05g3221 . 1 303 SNARE and Associated Proteins AT1G11250 77.9 1.1e-124 443.7
Tan08g1616 . 1 280 SNARE and Associated Proteins AT1G11250 62.9 1.7e-93 340.1
Tan03g1265 . 1 275 SNARE and Associated Proteins AT1G11250 56.7 1.7e-82 303.5
Tan10g1572 . 1 308 SNARE and Associated Proteins AT3G03800 73.1 3.9e-114 408.7
Tan05g0864 . 78 348 SNARE and Associated Proteins AT3G03800 58.3 2.3e-82 303.1
Tan10g1572 . 1 203 SNARE and Associated Proteins AT5G08080 76.4 1.9e-78 289.7
Tan05g0864 . 47 247 SNARE and Associated Proteins AT5G08080 59.7 6.3e-53 204.9
Tan01g2212 . 1 256 SNARE and Associated Proteins AT5G16830 59.9 6.6e-76 281.6
Tan01g2212 . 1 256 SNARE and Associated Proteins AT5G46860 66.8 6.6e-81 298.1
Tan01g2212 . 1 256 SNARE and Associated Proteins AT4G17730 61.3 1.3e-73 273.9
Tan01g2212 . 65 256 SNARE and Associated Proteins AT1G32270 60.9 1.3e-52 204.5
Tan04g0181 . 1 334 SNARE and Associated Proteins AT5G05760 65.7 1.4e-112 403.7
Tan02g2666 . 8 337 SNARE and Associated Proteins AT3G24350 62.6 1.1e-102 370.9
Tan06g0761 . 1 319 SNARE and Associated Proteins AT5G26980 66.8 1.9e-103 373.2
Tan06g0762 . 1 328 SNARE and Associated Proteins AT5G26980 65.0 1.6e-102 370.2
Tan08g0631 . 1 228 SNARE and Associated Proteins AT5G26980 78.1 2.1e-86 316.6
Tan08g0630 . 1 228 SNARE and Associated Proteins AT5G26980 78.1 2.1e-86 316.6
Tan08g0633 . 1 258 SNARE and Associated Proteins AT5G26980 69.0 1.2e-81 300.8
Tan08g0632 . 1 270 SNARE and Associated Proteins AT5G26980 65.9 3.0e-80 296.2
Tan08g0634 . 1 300 SNARE and Associated Proteins AT5G26980 59.3 1.7e-75 280.4
Tan06g0761 . 1 319 SNARE and Associated Proteins AT4G02195 67.2 1.6e-105 380.2
Tan06g0762 . 1 328 SNARE and Associated Proteins AT4G02195 65.4 3.3e-103 372.5
Tan08g0631 . 1 230 SNARE and Associated Proteins AT4G02195 68.0 9.1e-77 284.6
Tan08g0630 . 1 230 SNARE and Associated Proteins AT4G02195 68.0 9.1e-77 284.6
Tan08g0633 . 1 260 SNARE and Associated Proteins AT4G02195 60.2 5.1e-72 268.9
Tan08g0632 . 1 272 SNARE and Associated Proteins AT4G02195 57.5 1.3e-70 264.2
Tan08g0634 . 1 302 SNARE and Associated Proteins AT4G02195 51.8 7.2e-66 248.4
Tan06g0761 . 1 319 SNARE and Associated Proteins AT3G05710 63.4 4.3e-98 355.5
Tan06g0762 . 1 328 SNARE and Associated Proteins AT3G05710 61.7 4.7e-97 352.1
Tan08g0631 . 1 229 SNARE and Associated Proteins AT3G05710 80.3 1.3e-91 334.0
Tan08g0630 . 1 229 SNARE and Associated Proteins AT3G05710 80.3 1.3e-91 334.0
Tan08g0633 . 1 259 SNARE and Associated Proteins AT3G05710 71.0 7.6e-87 318.2
Tan08g0632 . 1 271 SNARE and Associated Proteins AT3G05710 67.9 1.9e-85 313.5
Tan08g0634 . 1 301 SNARE and Associated Proteins AT3G05710 61.1 1.1e-80 297.7
Tan01g3132 . 1 233 SNARE and Associated Proteins AT1G16240 71.7 2.0e-89 326.2
Tan01g1776 . 4 232 SNARE and Associated Proteins AT1G16240 67.7 1.5e-81 300.1
Tan01g1777 . 4 232 SNARE and Associated Proteins AT1G16240 67.7 1.5e-81 300.1
Tan01g3132 . 1 233 SNARE and Associated Proteins AT1G79590 71.2 1.9e-88 323.2
Tan01g1776 . 4 232 SNARE and Associated Proteins AT1G79590 68.1 7.7e-82 301.2
Tan01g1777 . 4 232 SNARE and Associated Proteins AT1G79590 68.1 7.7e-82 301.2
Tan09g0537 . 56 246 SNARE and Associated Proteins AT1G28490 70.7 1.7e-65 246.5
Tan11g2093 . 56 246 SNARE and Associated Proteins AT1G28490 70.2 1.9e-64 243.0
Tan11g2090 . 56 246 SNARE and Associated Proteins AT1G28490 70.2 1.9e-64 243.0
Tan11g2091 . 56 192 SNARE and Associated Proteins AT1G28490 66.4 3.4e-42 169.1
Tan11g2092 . 56 192 SNARE and Associated Proteins AT1G28490 66.4 3.4e-42 169.1
Tan08g1893 . 1 264 SNARE and Associated Proteins AT3G09740 79.7 8.5e-113 404.1
Tan05g0265 . 1 265 SNARE and Associated Proteins AT3G09740 68.3 9.4e-96 347.4
Tan05g0265 . 1 265 SNARE and Associated Proteins AT3G45280 65.7 8.5e-89 324.3
Tan08g1893 . 1 264 SNARE and Associated Proteins AT3G45280 64.4 1.2e-87 320.5
Tan08g1893 . 1 261 SNARE and Associated Proteins AT3G61450 68.6 2.1e-95 346.3
Tan05g0265 . 1 262 SNARE and Associated Proteins AT3G61450 60.8 3.0e-86 315.8
Tan11g0243 . 65 310 SNARE and Associated Proteins AT1G51740 74.1 2.6e-92 335.9
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0001189 1 6 1 1 1 2 3 2 2 2 2 2 3 2 3 3 2 4 3 2 3 1 2 3 3 2 3 8 3 2 77