Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Vvi1g346 ATGACCGGACCCCATCAATCTTCTGGCGCTCACAGCATCAGGGATACCATCTGTTACGCCGCTTCGGGTGCTGCTGCAGGTGCAATTGCTGCCACTTTTGTCTGCCCATTGGATGTGATCAAAACAAGATTACAGGTCCATGGCCTACCTGAAGTTCGGCATTCTGGCGTCCGAGGTAGCGTCATTATTACAAGCCTAGAAAACATAATAAGGACAGAGGGTTTGAAGGGAATGTATCGTGGCCTTTCGCCAACAATATTGGCACTACTTCCTAATTGGGCCGTGTACTTCACAGTGTATCAGAAATTAAAAGACGTACTGCATTCCCATGTGGATAGCAGCAGTCAACTTACAATTGGTGCAAATGTGATAGCTGCTTCAGGAGCTGGGGCTGCCACAGCAATTACAACGAATCCATTGTGGGTTGTTAAGACCAGACTCCAAACACAGACAATGAGGCCAAATGTGGTTCCTTACAAAGGCATATTTTCTGCTTTGAAAAGGATTGCACAAGAGGAAGGCATTCGAGGATTGTATAGTGGCCTTTTGCCTTCATTGGCTGGAATAACTCATGTTGCCATCCAATTTCCAGCATACGAGCAGATGAAGTCCTATTTAGCTAAAATGGGTGATACCACAGTTGATGAACTAGGTCCTGGGAATTTTGCAATTGCCTCATCCTTCTCTAAAGTACTTGCCTCCGTGATGACTTATCCCCATGAGGTTATTCGTTCAAGGCTGCAAGAGCAAGGGCAGGTCCGGAATTCAGAGAAGCACTATTCAGGTGTTATTGATTGCATTGAGAAAGTGTACAGAAAGGAAGGTCTTCCTGGTTTCTATCGTGGCTGTGCAACTAATCTATTGCGGACAACTCCATCTGCTGTTATAACTTTCACCAGTTTTGAGATGATTCATAGGTTTTTACAGCGACTTCTACATCCGGATGCAAAGCATTCATCAGCCAACCCTAATTCTGATGGCCATATTAAACCTCAGCGTGAAAATGGGAGAACCGTAGTAGAACAAAATGACTCCAGTGTAAGGCAGTCACAAGCTCAATCTACTAGTAACAGAACTCCAATTCCTATTGGAAACAAGGAGCAGCTACCTGCAAGCCACTGA 1122 45.01 MTGPHQSSGAHSIRDTICYAASGAAAGAIAATFVCPLDVIKTRLQVHGLPEVRHSGVRGSVIITSLENIIRTEGLKGMYRGLSPTILALLPNWAVYFTVYQKLKDVLHSHVDSSSQLTIGANVIAASGAGAATAITTNPLWVVKTRLQTQTMRPNVVPYKGIFSALKRIAQEEGIRGLYSGLLPSLAGITHVAIQFPAYEQMKSYLAKMGDTTVDELGPGNFAIASSFSKVLASVMTYPHEVIRSRLQEQGQVRNSEKHYSGVIDCIEKVYRKEGLPGFYRGCATNLLRTTPSAVITFTSFEMIHRFLQRLLHPDAKHSSANPNSDGHIKPQRENGRTVVEQNDSSVRQSQAQSTSNRTPIPIGNKEQLPASH* 374
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
1 3578145 3585426 + Vvi1g346 Vvi1g346 769546

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Vvi1g346 373 MobiDBLite consensus disorder prediction 338 363 - -
Vvi1g346 373 ProSiteProfiles Solute carrier (Solcar) repeat profile. 14 106 IPR018108 -
Vvi1g346 373 PANTHER MITOCHONDRIAL NICOTINAMIDE ADENINE DINUCLEOTIDE TRANSPORTER 1-RELATED-RELATED 11 318 IPR044712 GO:0006862|GO:0055085
Vvi1g346 373 Pfam Mitochondrial carrier protein 116 208 IPR018108 -
Vvi1g346 373 Pfam Mitochondrial carrier protein 221 309 IPR018108 -
Vvi1g346 373 Pfam Mitochondrial carrier protein 20 109 IPR018108 -
Vvi1g346 373 MobiDBLite consensus disorder prediction 316 373 - -
Vvi1g346 373 PANTHER NICOTINAMIDE ADENINE DINUCLEOTIDE TRANSPORTER 1, CHLOROPLASTIC 11 318 - -
Vvi1g346 373 SUPERFAMILY Mitochondrial carrier 15 303 IPR023395 -
Vvi1g346 373 Gene3D Mitochondrial carrier domain 14 308 IPR023395 -
Vvi1g346 373 ProSiteProfiles Solute carrier (Solcar) repeat profile. 117 205 IPR018108 -
Vvi1g346 373 PRINTS Mitochondrial carrier protein signature 19 32 IPR002067 GO:0055085
Vvi1g346 373 PRINTS Mitochondrial carrier protein signature 32 46 IPR002067 GO:0055085
Vvi1g346 373 PRINTS Mitochondrial carrier protein signature 81 101 IPR002067 GO:0055085
Vvi1g346 373 PRINTS Mitochondrial carrier protein signature 132 150 IPR002067 GO:0055085
Vvi1g346 373 PRINTS Mitochondrial carrier protein signature 179 197 IPR002067 GO:0055085
Vvi1g346 373 PRINTS Mitochondrial carrier protein signature 226 248 IPR002067 GO:0055085
Vvi1g346 373 ProSiteProfiles Solute carrier (Solcar) repeat profile. 217 307 IPR018108 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Vvi1g346 K15115 SLC25A32, MFT; solute carrier family 25 (mitochondrial folate transporter), member 32 - vvi:100264527 711.835
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi1g346 . . Bda01g02021 Bda11g00163 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Cone6ag0430 Cone9ag0448 . Csa05g02065 . . . . . Bda11g00163 . Bpe02g02209 . . . . Cmo15g00963 . Cma15g00924 . Car15g00866 Cpe13g00396 . Bhi12g00835 . . . Hepe02g2690 . Lcy10g1474 Cla01g00571 Cam01g0597 Cec01g0586 Cco01g0612 Clacu01g0590 Cmu01g0562 Cre09g1945 Lsi09g00619 . Chy09g00893 Cme09g01426
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Vvi6g422 . 65 449 Chloroplast and Mitochondria Gene Families AT2G28800 68.1 1.3e-131 466.8
Vvi1g589 . 51 396 Chloroplast and Mitochondria Gene Families AT2G28800 56.1 3.3e-100 362.5
Vvi12g867 . 3 199 Chloroplast and Mitochondria Gene Families AT1G15820 58.1 3.0e-72 268.9
Vvi19g298 ECH 12 232 Chloroplast and Mitochondria Gene Families AT3G27690 76.1 3.5e-96 348.6
Vvi12g680 ECH 1 173 Chloroplast and Mitochondria Gene Families AT3G27690 70.9 3.8e-87 318.5
Vvi7g460 . 17 184 Chloroplast and Mitochondria Gene Families AT3G27690 68.2 9.1e-81 297.4
Vvi18g26 . 102 323 Chloroplast and Mitochondria Gene Families AT3G27690 51.8 7.8e-56 214.5
Vvi10g365 . 22 149 Chloroplast and Mitochondria Gene Families AT3G27690 63.1 1.7e-55 213.4
Vvi12g46 ECH 15 148 Chloroplast and Mitochondria Gene Families AT3G27690 54.1 4.3e-54 208.8
Vvi18g1777 . 72 275 Chloroplast and Mitochondria Gene Families AT3G27690 54.8 3.1e-52 202.6
Vvi1g1250 . 3 272 Chloroplast and Mitochondria Gene Families AT3G61470 80.4 6.0e-129 457.2
Vvi11g48 . 52 260 Chloroplast and Mitochondria Gene Families AT3G61470 67.0 2.1e-86 315.8
Vvi17g566 ECH 22 242 Chloroplast and Mitochondria Gene Families AT3G61470 51.7 1.2e-65 246.9
Vvi13g497 . 1 153 Chloroplast and Mitochondria Gene Families AT3G54890 89.5 1.9e-80 295.8
Vvi18g26 . 28 329 Chloroplast and Mitochondria Gene Families AT1G76570 78.8 8.3e-144 506.9
Vvi15g2 . 1 208 Chloroplast and Mitochondria Gene Families AT1G61520 67.0 3.5e-95 345.1
Vvi19g298 ECH 1 232 Chloroplast and Mitochondria Gene Families AT2G05070 72.5 1.4e-96 349.7
Vvi12g680 ECH 1 173 Chloroplast and Mitochondria Gene Families AT2G05070 70.4 8.4e-86 313.9
Vvi7g460 . 17 184 Chloroplast and Mitochondria Gene Families AT2G05070 67.7 1.5e-79 293.1
Vvi10g365 . 22 149 Chloroplast and Mitochondria Gene Families AT2G05070 63.1 2.0e-55 213.0
Vvi18g26 . 102 326 Chloroplast and Mitochondria Gene Families AT2G05070 51.6 5.9e-55 211.5
Vvi12g46 ECH 15 148 Chloroplast and Mitochondria Gene Families AT2G05070 54.1 5.0e-54 208.4
Vvi19g298 ECH 2 203 Chloroplast and Mitochondria Gene Families AT2G05100 71.4 4.8e-80 295.0
Vvi12g680 ECH 1 144 Chloroplast and Mitochondria Gene Families AT2G05100 66.2 1.8e-66 250.0
Vvi7g460 . 17 155 Chloroplast and Mitochondria Gene Families AT2G05100 63.9 2.9e-61 232.6
Vvi18g1777 . 72 259 Chloroplast and Mitochondria Gene Families AT2G05100 54.1 5.6e-44 175.3
Vvi10g365 . 22 120 Chloroplast and Mitochondria Gene Families AT2G05100 57.3 3.9e-37 152.5
Vvi19g298 ECH 1 232 Chloroplast and Mitochondria Gene Families AT1G29930 70.0 1.7e-94 342.8
Vvi7g460 . 14 184 Chloroplast and Mitochondria Gene Families AT1G29930 71.4 7.2e-85 310.8
Vvi12g680 ECH 1 173 Chloroplast and Mitochondria Gene Families AT1G29930 63.7 1.5e-74 276.6
Vvi12g46 ECH 1 148 Chloroplast and Mitochondria Gene Families AT1G29930 57.4 3.6e-60 228.8
Vvi10g365 . 22 149 Chloroplast and Mitochondria Gene Families AT1G29930 65.6 1.7e-57 219.9
Vvi18g1777 . 72 275 Chloroplast and Mitochondria Gene Families AT1G29930 53.3 6.5e-54 208.0
Vvi19g298 ECH 1 232 Chloroplast and Mitochondria Gene Families AT1G29920 70.0 1.7e-94 342.8
Vvi7g460 . 14 184 Chloroplast and Mitochondria Gene Families AT1G29920 71.4 7.2e-85 310.8
Vvi12g680 ECH 1 173 Chloroplast and Mitochondria Gene Families AT1G29920 63.7 1.5e-74 276.6
Vvi12g46 ECH 1 148 Chloroplast and Mitochondria Gene Families AT1G29920 57.4 3.6e-60 228.8
Vvi10g365 . 22 149 Chloroplast and Mitochondria Gene Families AT1G29920 65.6 1.7e-57 219.9
Vvi18g1777 . 72 275 Chloroplast and Mitochondria Gene Families AT1G29920 53.3 6.5e-54 208.0
Vvi19g298 ECH 1 232 Chloroplast and Mitochondria Gene Families AT1G29910 70.0 1.7e-94 342.8
Vvi7g460 . 14 184 Chloroplast and Mitochondria Gene Families AT1G29910 71.4 7.2e-85 310.8
Vvi12g680 ECH 1 173 Chloroplast and Mitochondria Gene Families AT1G29910 63.7 1.5e-74 276.6
Vvi12g46 ECH 1 148 Chloroplast and Mitochondria Gene Families AT1G29910 57.4 3.6e-60 228.8
Vvi10g365 . 22 149 Chloroplast and Mitochondria Gene Families AT1G29910 65.6 1.7e-57 219.9
Vvi18g1777 . 72 275 Chloroplast and Mitochondria Gene Families AT1G29910 53.3 6.5e-54 208.0
Vvi18g1777 . 11 291 Chloroplast and Mitochondria Gene Families AT4G10340 87.2 5.7e-141 497.3
Vvi19g298 ECH 13 219 Chloroplast and Mitochondria Gene Families AT4G10340 51.4 5.4e-51 198.4
Vvi19g298 ECH 1 232 Chloroplast and Mitochondria Gene Families AT2G34420 70.4 1.7e-94 342.8
Vvi7g460 . 14 184 Chloroplast and Mitochondria Gene Families AT2G34420 72.3 4.9e-86 314.7
Vvi12g680 ECH 1 173 Chloroplast and Mitochondria Gene Families AT2G34420 63.2 2.5e-74 275.8
Vvi12g46 ECH 1 148 Chloroplast and Mitochondria Gene Families AT2G34420 57.9 1.2e-60 230.3
Vvi10g365 . 22 149 Chloroplast and Mitochondria Gene Families AT2G34420 66.1 9.7e-58 220.7
Vvi18g1777 . 72 275 Chloroplast and Mitochondria Gene Families AT2G34420 52.9 1.9e-53 206.5
Vvi19g298 ECH 1 232 Chloroplast and Mitochondria Gene Families AT2G34430 71.1 1.7e-94 342.8
Vvi7g460 . 14 184 Chloroplast and Mitochondria Gene Families AT2G34430 72.3 6.5e-86 314.3
Vvi12g680 ECH 1 173 Chloroplast and Mitochondria Gene Families AT2G34430 63.1 1.3e-73 273.5
Vvi12g46 ECH 13 148 Chloroplast and Mitochondria Gene Families AT2G34430 57.8 2.6e-58 222.6
Vvi10g365 . 22 149 Chloroplast and Mitochondria Gene Families AT2G34430 66.1 9.7e-58 220.7
Vvi18g1777 . 72 275 Chloroplast and Mitochondria Gene Families AT2G34430 52.9 2.5e-53 206.1
Vvi18g26 . 109 323 Chloroplast and Mitochondria Gene Families AT2G34430 50.7 4.7e-52 201.8
Vvi14g1214 . 51 311 Chloroplast and Mitochondria Gene Families AT5G40810 91.2 2.6e-140 495.0
Vvi9g478 . 57 317 Chloroplast and Mitochondria Gene Families AT5G40810 90.0 9.9e-140 493.0
Vvi14g1214 . 1 311 Chloroplast and Mitochondria Gene Families AT3G27240 85.5 5.1e-151 530.8
Vvi9g478 . 30 317 Chloroplast and Mitochondria Gene Families AT3G27240 84.7 6.2e-141 497.3
Vvi6g700 ECH 1 323 Chloroplast and Mitochondria Gene Families AT2G30160 72.4 3.2e-135 478.4
Vvi8g316 ECH 2 110 Chloroplast and Mitochondria Gene Families AT2G30160 72.6 2.4e-42 169.9
Vvi6g700 ECH 1 323 Chloroplast and Mitochondria Gene Families AT1G07030 74.7 3.4e-137 485.0
Vvi8g316 ECH 1 110 Chloroplast and Mitochondria Gene Families AT1G07030 75.7 6.3e-43 171.8
Vvi7g348 . 1 309 Chloroplast and Mitochondria Gene Families AT2G47490 80.3 4.7e-144 507.7
Vvi1g346 . 14 320 Chloroplast and Mitochondria Gene Families AT2G47490 66.1 7.0e-116 414.1
Vvi1g346 . 12 366 Chloroplast and Mitochondria Gene Families AT1G25380 64.3 2.8e-124 442.2
Vvi7g348 . 9 301 Chloroplast and Mitochondria Gene Families AT1G25380 65.4 1.6e-108 389.8
Vvi12g644 . 1 576 Chloroplast and Mitochondria Gene Families AT4G21490 73.9 9.0e-250 859.8
Vvi12g645 . 1 578 Chloroplast and Mitochondria Gene Families AT4G21490 65.3 7.1e-223 770.4
Vvi4g589 . 7 178 Chloroplast and Mitochondria Gene Families AT1G17530 61.5 9.0e-55 210.3
Vvi4g589 . 11 183 Chloroplast and Mitochondria Gene Families AT3G04800 57.5 2.4e-50 195.7
Vvi4g589 . 2 183 Chloroplast and Mitochondria Gene Families AT1G72750 59.5 4.9e-56 214.5
Vvi1g249 ECH 11 243 Chloroplast and Mitochondria Gene Families AT1G26100 66.0 3.3e-81 298.5
Vvi14g922 ECH 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 72.7 2.3e-92 335.5
Vvi16g662 . 22 231 Chloroplast and Mitochondria Gene Families AT4G25570 68.0 2.7e-82 302.4
Vvi1g540 . 3 216 Chloroplast and Mitochondria Gene Families AT1G14730 52.8 8.4e-63 237.3
Vvi14g1108 ECH 1 273 Chloroplast and Mitochondria Gene Families AT5G14040 90.5 1.0e-145 513.5
Vvi17g35 ECH 1 274 Chloroplast and Mitochondria Gene Families AT5G14040 88.3 1.8e-142 502.7
Vvi3g302 . 6 296 Chloroplast and Mitochondria Gene Families AT5G14040 50.8 2.4e-86 316.2
Vvi7g1224 . 17 300 Chloroplast and Mitochondria Gene Families AT5G14040 50.3 4.7e-82 302.0
Vvi17g35 ECH 2 274 Chloroplast and Mitochondria Gene Families AT3G48850 79.9 9.3e-128 453.8
Vvi14g1108 ECH 2 272 Chloroplast and Mitochondria Gene Families AT3G48850 78.6 2.1e-127 452.6
Vvi7g1224 . 17 298 Chloroplast and Mitochondria Gene Families AT3G48850 51.7 2.6e-85 312.8
Vvi3g302 . 13 296 Chloroplast and Mitochondria Gene Families AT3G48850 52.1 7.4e-85 311.2
Vvi3g302 . 1 309 Chloroplast and Mitochondria Gene Families AT2G17270 73.2 2.8e-133 471.9
Vvi7g1224 . 7 300 Chloroplast and Mitochondria Gene Families AT2G17270 68.0 1.3e-117 419.9
Vvi14g1108 ECH 1 269 Chloroplast and Mitochondria Gene Families AT2G17270 51.3 4.1e-76 282.0
Vvi17g35 ECH 1 275 Chloroplast and Mitochondria Gene Families AT2G17270 50.7 2.0e-75 279.6
Vvi14g1007 . 16 318 Chloroplast and Mitochondria Gene Families AT5G15640 74.7 1.1e-127 453.4
Vvi5g230 . 19 319 Chloroplast and Mitochondria Gene Families AT5G15640 50.8 3.0e-82 302.4
Vvi4g138 . 1 193 Chloroplast and Mitochondria Gene Families AT5G26200 59.1 4.6e-68 255.4
Vvi4g138 . 1 198 Chloroplast and Mitochondria Gene Families AT1G72820 62.7 2.0e-74 276.6
Vvi2g29 ECH 91 294 Chloroplast and Mitochondria Gene Families AT5G52570 56.9 1.8e-55 213.0
Vvi16g754 ECH 1 188 Chloroplast and Mitochondria Gene Families AT5G52570 54.8 2.1e-48 189.5
Vvi2g29 ECH 48 213 Chloroplast and Mitochondria Gene Families AT4G25700 68.5 6.2e-66 247.7
Vvi16g754 ECH 1 104 Chloroplast and Mitochondria Gene Families AT4G25700 90.4 3.9e-52 201.8
Vvi19g292 . 19 359 Chloroplast and Mitochondria Gene Families AT5G54290 75.1 1.0e-126 450.3
Vvi11g848 . 87 574 Chloroplast and Mitochondria Gene Families AT2G18710 83.4 8.9e-231 796.6
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002161 2 2 0 1 2 2 3 2 2 2 2 2 2 2 2 3 2 4 2 2 2 2 2 2 2 2 2 4 2 2 63